From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001121000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 1394770..1394940
  • synteny block?: BlockID0006410
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0249
    08BA02176:
    C248_0236
    11819-97:
    MS7_0237
    71193:
    ST398NM01_0261
    ECT-R 2:
    ECTR2_210
    ED133:
    SAOV_0188
    ED98:
    SAAV_0216
    HO 5096 0412:
    SAEMRSA15_02080
    JH1:
    SaurJH1_0240
    JH9:
    SaurJH9_0234
    JKD6008:
    SAA6008_00222
    JKD6159:
    SAA6159_00226
    LGA251:
    SARLGA251_02130
    M013:
    M013TW_0230
    MRSA252:
    SAR0244
    MSHR1132:
    SAMSHR1132_02170
    MSSA476:
    SAS0225
    Mu3:
    SAHV_0248
    Mu50:
    SAV0249
    MW2:
    MW0225
    RF122:
    SAB0188
    ST398:
    SAPIG0261
    T0131:
    SAT0131_00240
    TCH60:
    HMPREF0772_10254
    TW20:
    SATW20_02510
    USA300_TCH1516:
    USA300HOU_0260
    VC40:
    SAVC_00985

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVESMLTFMLGPLRQITDFYMEHLLVSNSIVIAGYFATGIFKKKKVVN
    N315            MVESMLTFMLGPLRQITDFYMEHLLVSNSIVIAGYFATGIFKKKKVVN
    NCTC8325        MVESMLTFMLGPLRQITDFYMEHLLVSNSIVIAGYFATGIFKKKKVVN
    USA300_FPR3757  MVESMLTFMLGPLRQITDFYMEHLLVSNSIVIAGYFATGIFKKKKVVN
                    ************************************************