From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001124000
  • symbol?: tarJ'
  • description?: xylitol dehydrogenase

      descriptions from strain specific annotations:

    • xylitol dehydrogenase
    • alcohol dehydrogenase, zinc-containing
    • alcohol dehydrogenase GroES-like domain protein
    • zinc-binding dehydrogenase family protein
    • putative alcohol dehydrogenase
    • zinc-containing alcohol dehydrogenase
    • ribitol-5-phosphate dehydrogenase
    • putative zinc-binding dehydrogenase
    • pseudogene
    • Ribitol-5-phosphate 2-dehydrogenase
    • putative ribitol-5-phosphate dehydrogenase (Ribulose-5-P reductase)
  • strand?: +
  • coordinates?: 1397304..1398357
  • synteny block?: BlockID0006440
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0252
    08BA02176:
    C248_0239
    11819-97:
    MS7_0240
    71193:
    ST398NM01_0264
    ECT-R 2:
    ECTR2_213
    ED133:
    SAOV_0191
    ED98:
    SAAV_0220
    HO 5096 0412:
    SAEMRSA15_02110
    JH1:
    SaurJH1_0243
    JH9:
    SaurJH9_0237
    JKD6008:
    SAA6008_00225
    JKD6159:
    SAA6159_00229
    LGA251:
    SARLGA251_02160 (tarJ')
    M013:
    M013TW_0233
    MRSA252:
    SAR0247
    MSHR1132:
    SAMSHR1132_02200
    MSSA476:
    SAS0228
    Mu3:
    SAHV_0251
    Mu50:
    SAV0252
    MW2:
    MW0228
    RF122:
    SAB0191
    ST398:
    SAPIG0264
    T0131:
    SAT0131_00244
    TCH60:
    HMPREF0772_10251 (tarJ2)
    TW20:
    SATW20_02540 (tarJ')
    USA300_TCH1516:
    USA300HOU_0263
    VC40:
    SAVC_01000

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MINQVYQLVAPRQFDVTYNNVDIYGNHVIVRPLYLSICAADQRYYTGRRDENVLRKKLPM
    N315            MINQVYQLVAPRQFDVTYNNVDIYGNHVIVRPLYLSICAADQRYYTGRRDENVLRKKLPM
    NCTC8325        MINQVYQLVAPRQFDVTYNNVDIYGNHVIVRPLYLSICAADQRYYTGRRDENVLRKKLPM
    Newman          MINQVYQLVAPRQFDVTYNNVDIYGNHVIVRPLYLSICAADQRYYTGRRDENVLRKKLPM
    USA300_FPR3757  MINQVYQLVAPRQFDVTYNNVDIYGNHVIVRPLYLSICAADQRYYTGRRDENVLRKKLPM
                    ************************************************************

    COL             SLVHEAVGEVVFDSKGVFEKGTKVVMVPNTPTEQHHIIAENYLASSYFRSSGYDGFMQDY
    N315            SLVHEAVGEVVFDSKGVFEKGTKVVMVPNTPTEQHHIIAENYLASSYFRSSGYDGFMQDY
    NCTC8325        SLVHEAVGEVVFDSKGVFEKGTKVVMVPNTPTEQHHIIAENYLASSYFRSSGYDGFMQDY
    Newman          SLVHEAVGEVVFDSKGVFEKGTKVVMVPNTPTEQHHIIAENYLASSYFRSSGYDGFMQDY
    USA300_FPR3757  SLVHEAVGEVVFDSKGVFEKGTKVVMVPNTPTEQHHIIAENYLASSYFRSSGYDGFMQDY
                    ************************************************************

    COL             VVMAHDRIVPLPNDIDLSTISYTELVSVSYHAIQRFERKSIPLKTSFGIWGDGNLGYITA
    N315            VVMAHDRIVPLPNDIDLSTISYTELVSVSYHAIQRFERKSIPLKNSFGIWGDGNLGYITA
    NCTC8325        VVMAHDRIVPLPNDIDLSTISYTELVSVSYHAIQRFERKSIPLKTSFGIWGDGNLGYITA
    Newman          VVMAHDRIVPLPNDIDLSTISYTELVSVSYHAIQRFERKSIPLKTSFGIWGDGNLGYITA
    USA300_FPR3757  VVMAHDRIVPLPNDIDLSTISYTELVSVSYHAIQRFERKSIPLKTSFGIWGDGNLGYITA
                    ********************************************.***************

    COL             ILLRKLYPEAKTYVFGKTDYKLSHFSFVDDIFTVNQIPDDLKIDHAFECVGGKGSQVALQ
    N315            ILLRKLYPEAKIYVFGKTDYKLSHFSFVDDIFTVNQIPDDLKIDHAFECVGGKGSQVALQ
    NCTC8325        ILLRKLYPEAKTYVFGKTDYKLSHFSFVDDIFTVNQIPDDLKIDHAFECVGGKGSQVALQ
    Newman          ILLRKLYPEAKTYVFGKTDYKLSHFSFVDDIFTVNQIPDDLKIDHAFECVGGKGSQVALQ
    USA300_FPR3757  ILLRKLYPEAKTYVFGKTDYKLSHFSFVDDIFTVNQIPDDLKIDHAFECVGGKGSQVALQ
                    *********** ************************************************

    COL             QIVEHISPEGSIALLGVSELPVEVNTRLVLEKGLTLIGSSRSGSKDFEQVVDLYRKYPDI
    N315            QIVEHISPEGSIALLGVSELPVEVNTRLVLEKGLTLIGSSRSGSKDFEQVVDLYRKYPDI
    NCTC8325        QIVEHISPEGSIALLGVSELPVEVNTRLVLEKGLTLIGSSRSGSKDFEQVVDLYRKYPDI
    Newman          QIVEHISPEGSIALLGVSELPVEVNTRLVLEKGLTLIGSSRSGSKDFEQVVDLYRKYPDI
    USA300_FPR3757  QIVEHISPEGSIALLGVSELPVEVNTRLVLEKGLTLIGSSRSGSKDFEQVVDLYRKYPDI
                    ************************************************************

    COL             VEKLALLKGHEINVCTMQDIVQAFEMDLSTSWGKTVLKWTI
    N315            VEKLALLKGHEINVCTMQDIVQAFEMDLSTSWGKTVLKWTI
    NCTC8325        VEKLALLKGHEINVCTMQDIVQAFEMDLSTSWGKTVLKWTI
    Newman          VEKLALLKGHEINVCTMQDIVQAFEMDLSTSWGKTVLKWTI
    USA300_FPR3757  VEKLALLKGHEINVCTMQDIVQAFEMDLSTSWGKTVLKWTI
                    *****************************************