From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001132000
  • symbol?: tarF
  • description?: CDP-glycerol--glycerophosphate glycerophosphotransferase

      descriptions from strain specific annotations:

    • CDP-glycerol--glycerophosphate glycerophosphotransferase
    • TagF domain-containing protein
    • teichoic acid biosynthesis protein F
    • putative teichoic acid biosynthesis protein F
    • CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase
    • cdp-glycerol:poly(glycerophosphate) glycerophosphotransFerase (polyglycerol phosphate polymerase) (cgptase) (majorteichoic acid biosynthesis protein f)
    • CDP-glycerol:poly domain protein
    • CDP-glycerol glycerophosphotransferase
    • CDP-ribitol:poly(ribitol phosphate) ribitol phosphotransferase
    • glycerophosphotransferase, TarF
    • Poly(glycerophosphate) glycerophosphotransferase family protein
    • TagF domain protein
    • trancated TagF
  • strand?: +
  • coordinates?: 1401281..1402514
  • synteny block?: BlockID0006520
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0254
    08BA02176:
    C248_0242
    11819-97:
    MS7_0244
    71193:
    ST398NM01_0267
    ECT-R 2:
    ECTR2_215
    ED133:
    SAOV_0193
    ED98:
    SAAV_0222
    HO 5096 0412:
    SAEMRSA15_02130
    JH1:
    SaurJH1_0245
    JH9:
    SaurJH9_0239
    JKD6008:
    SAA6008_00228 (tarF)
    JKD6159:
    SAA6159_00231 (tarF)
    LGA251:
    SARLGA251_02180 (tarF)
    M013:
    M013TW_0235
    MRSA252:
    SAR0251
    MSHR1132:
    SAMSHR1132_02220
    MSSA476:
    SAS0231
    Mu3:
    SAHV_0253
    Mu50:
    SAV0254
    MW2:
    MW0230
    RF122:
    SAB0193
    ST398:
    SAPIG0267
    T0131:
    SAT0131_00247
    TCH60:
    HMPREF0772_10248 (tagF)
    TW20:
    SATW20_02560 (tarF)
    USA300_TCH1516:
    USA300HOU_0265 (tagF)
    VC40:
    SAVC_01010

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIKNTIKKLIEHSIYTTFKLLSKLPNKNLIYFESFHGKQYSDNPKALYEYLTEHSDAQLI
    N315            MIKNTIKKLIEHSIYTTFKLLSKLPNKNLIYFESFHGKQYSDNPKALYEYLTEHSDAQLI
    NCTC8325        MIKNTIKKLIEHSIYTTFKLLSKLPNKNLIYFESFHGKQYSDNPKALYEYLTEHSDAQLI
    Newman          MIKNTIKKLIEHSIYTTFKLLSKLPNKNLIYFESFHGKQYSDNPKALYEYLTEHSDAQLI
    USA300_FPR3757  MIKNTIKKLIEHSIYTTFKLLSKLPNKNLIYFESFHGKQYSDNPKALYEYLTEHSDAQLI
                    ************************************************************

    COL             WGVKKGYEHIFQQHNVPYVTKFSMKWFLAMPRAKAWMINTRTPDWLYKSPRTTYLQTWHG
    N315            WGVKKGYEHIFQQYNVPYVTKFSMKWFLAMPRAKAWMINTRTPDWLYKSPRTTYLQTWHG
    NCTC8325        WGVKKGYEHIFQQHNVPYVTKFSMKWFLAMPRAKAWMINTRTPDWLYKSPRTTYLQTWHG
    Newman          WGVKKGYEHIFQQHNVPYVTKFSMKWFLAMPRAKAWMINTRTPDWLYKSPRTTYLQTWHG
    USA300_FPR3757  WGVKKGYEHIFQQHNVPYVTKFSMKWFLAMPRAKAWMINTRTPDWLYKSPRTTYLQTWHG
                    *************:**********************************************

    COL             TPLKKIGLDISNVKMLGTNTQNYQDGFKKESQRWDYLVSPNPYSTSIFQNAFHVSRDKIL
    N315            TPLKKIGLDISNVKMLGTNTQNYQDGFKKESQRWDYLVSPNPYSTSIFQHAFHVSRDKIL
    NCTC8325        TPLKKIGLDISNVKMLGTNTQNYQDGFKKESQRWDYLVSPNPYSTSIFQNAFHVSRDKIL
    Newman          TPLKKIGLDISNVKMLGTNTQNYQDGFKKESQRWDYLVSPNPYSTSIFQNAFHVSRDKIL
    USA300_FPR3757  TPLKKIGLDISNVKMLGTNTQNYQDGFKKESQRWDYLVSPNPYSTSIFQNAFHVSRDKIL
                    *************************************************:**********

    COL             ETGYPRNDKLSHKRNDTEYINGIKTRLNIPLDKKVIMYAPTWRDDEAIREGSYQFNVNFD
    N315            ETGYPRNDKLSHKRNDTEYINGIKTRLNIPLDKKVIMYAPTWRDDEAIREGSYQFNVNFD
    NCTC8325        ETGYPRNDKLSHKRNDTEYINGIKTRLNIPLDKKVIMYAPTWRDDEAIREGSYQFNVNFD
    Newman          ETGYPRNDKLSHKRNDTEYINGIKTRLNIPLDKKVIMYAPTWRDDEAIREGSYQFNVNFD
    USA300_FPR3757  ETGYPRNDKLSHKRNDTEYINGIKTRLNIPLDKKVIMYAPTWRDDEAIREGSYQFNVNFD
                    ************************************************************

    COL             IEALRQALDDDYVILLRMHYLVVTRIDEHDDFVKDVSDYEDISDLYLISDALVTDYSSVM
    N315            IEALRQALDDDYVILLRMHYLVVTRIDEHDDFVKDVSDYEDISDLYLISDALVTDYSSVM
    NCTC8325        IEALRQALDDDYVILLRMHYLVVTRIDEHDDFVKDVSDYEDISDLYLISDALVTDYSSVM
    Newman          IEALRQALDDDYVILLRMHYLVVTRIDEHDDFVKDVSDYEDISDLYLISDALVTDYSSVM
    USA300_FPR3757  IEALRQALDDDYVILLRMHYLVVTRIDEHDDFVKDVSDYEDISDLYLISDALVTDYSSVM
                    ************************************************************

    COL             FDFGVLKRPQIFYAYDLDKYGDELRGFYMDYKKELPGPIVENQTALIDALKQIDETANEY
    N315            FDFGVLKRPQIFYAYDLDKYGDELRGFYMDYKKELPGPIVENQTALIDALKQIDETANEY
    NCTC8325        FDFGVLKRPQIFYAYDLDKYGDELRGFYMDYKKELPGPIVENQTALIDALKQIDETANEY
    Newman          FDFGVLKRPQIFYAYDLDKYGDELRGFYMDYKKELPGPIIENQTALIDALKQIDETANEY
    USA300_FPR3757  FDFGVLKRPQIFYAYDLDKYGDELRGFYMDYKKELPGPIVENQTALIDALKQIDETANEY
                    ***************************************:********************

    COL             IEARTVFYQKFCSLEDGQASQRICQTIFK
    N315            IEARTVFYQKFCSLEDGQASQRICQTIFK
    NCTC8325        IEARTVFYQKFCSLEDGQASQRICQTIFK
    Newman          IEARTVFYQKFCSLEDGQASQRICQTIFK
    USA300_FPR3757  IEARTVFYQKFCSLEDGQASQRICQTIFK
                    *****************************