From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001134000
  • symbol?: tarJ
  • description?: xylitol dehydrogenase

      descriptions from strain specific annotations:

    • xylitol dehydrogenase
    • alcohol dehydrogenase
    • alcohol dehydrogenase, zinc-containing
    • alcohol dehydrogenase GroES-like domain protein
    • putative zinc-binding dehydrogenase
    • alcohol dehydrogenase, zinc-dependent
    • ribitol-5-phosphate 2-dehydrogenase
    • ribitol-5-phosphate dehydrogenase
    • zinc (Zn2+)-binding dehydrogenase
    • zinc-containing alcohol dehydrogenase
    • zinc-binding dehydrogenase family protein
  • strand?: +
  • coordinates?: 1403475..1404527
  • synteny block?: BlockID0006540
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0256
    08BA02176:
    C248_0244
    11819-97:
    MS7_0246
    71193:
    ST398NM01_0269
    ECT-R 2:
    ECTR2_217
    ED133:
    SAOV_0195
    ED98:
    SAAV_0224
    HO 5096 0412:
    SAEMRSA15_02150
    JH1:
    SaurJH1_0247
    JH9:
    SaurJH9_0241
    JKD6008:
    SAA6008_00230
    JKD6159:
    SAA6159_00233
    LGA251:
    SARLGA251_02200 (tarJ)
    M013:
    M013TW_0237
    MRSA252:
    SAR0253
    MSHR1132:
    SAMSHR1132_02240
    MSSA476:
    SAS0233
    Mu3:
    SAHV_0255
    Mu50:
    SAV0256
    MW2:
    MW0232
    RF122:
    SAB0195
    ST398:
    SAPIG0269
    T0131:
    SAT0131_00249 (greA)
    TCH60:
    HMPREF0772_10246 (tarJ)
    TW20:
    SATW20_02580 (tarJ)
    USA300_TCH1516:
    USA300HOU_0267
    VC40:
    SAVC_01020

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MINQVYQLVAPRQFEVTYNNVDIYSDYVIVRPLYMSICAADQRYYTGSRDENVLSQKLPM
    N315            MINQVYQLVAPRQFEVTYNNVDIYSDYVIVRPLYMSICAADQRYYTGSRDENVLSQKLPM
    NCTC8325        MINQVYQLVAPRQFEVTYNNVDIYSDYVIVRPLYMSICAADQRYYTGSRDENVLSQKLPM
    Newman          MINQVYQLVAPRQFEVTYNNVDIYSDYVIVRPLYMSICAADQRYYTGSRDENVLSQKLPM
    USA300_FPR3757  MINQVYQLVAPRQFEVTYNNVDIYSDYVIVRPLYMSICAADQRYYTGSRDENVLSQKLPM
                    ************************************************************

    COL             SLIHEGVGEVVFDSKGVFNKGTKVVMVPNTPTEKDDVIAENYLKSSYFRSSGHDGFMQDF
    N315            SLIHEGVGEVVFDSKGVFNKGTKVVMVPNTPTEKDDVIAENYLKSSYFRSSGHDGFMQDF
    NCTC8325        SLIHEGVGEVVFDSKGVFNKGTKVVMVPNTPTEKDDVIAENYLKSSYFRSSGHDGFMQDF
    Newman          SLIHEGVGEVVFDSKGVFNKGTKVVMVPNTPTEKDDVIAENYLKSSYFRSSGHDGFMQDF
    USA300_FPR3757  SLIHEGVGEVVFDSKGVFNKGTKVVMVPNTPTEKDDVIAENYLKSSYFRSSGHDGFMQDF
                    ************************************************************

    COL             VLLNHDRAVPLPDDIDLSIISYTELVTVSLHAIRRFEKKSISNKNTFGIWGDGNLGYITA
    N315            VLLNHDRAVPLPDDIDLSIISYTELVTVSLHAIRRFEKKSISNKNTFGIWGDGNLGYITA
    NCTC8325        VLLNHDRAVPLPDDIDLSIISYTELVTVSLHAIRRFEKKSISNKNTFGIWGDGNLGYITA
    Newman          VLLNHDRAVPLPDDIDLSIISYTELVTVSLHAIRRFEKKSISNKNTFGIWGDGNLGYITA
    USA300_FPR3757  VLLNHDRAVPLPDDIDLSIISYTELVTVSLHAIRRFEKKSISNKNTFGIWGDGNLGYITA
                    ************************************************************

    COL             ILLRKLYPESKIYVFGKTDYKLSHFSFVDDVFFINKIPEGLTFDHAFECVGGRGSQSAIN
    N315            ILLRKLYPESKIYVFGKTDYKLSHFSFVDDVFFINKIPEGLTFDHAFECVGGRGSQSAIN
    NCTC8325        ILLRKLYPESKIYVFGKTDYKLSHFSFVDDVFFINKIPEGLTFDHAFECVGGRGSQSAIN
    Newman          ILLRKLYPESKIYVFGKTDYKLSHFSFVDDVFFINKIPEGLTFDHAFECVGGRGSQSAIN
    USA300_FPR3757  ILLRKLYPESKIYVFGKTDYKLSHFSFVDDVFFINKIPEGLTFDHAFECVGGRGSQSAIN
                    ************************************************************

    COL             QMIDYISPEGSIALLGVSEFPVEVNTRLVLEKGLTLIGSSRSGSKDFQDVVDLYIQYPDI
    N315            QMIDYISPEGSIALLGVSEFPVEVNTRLVLEKGLTLIGSSRSGSKDFQDVVDLYIQYPDI
    NCTC8325        QMIDYISPEGSIALLGVSEFPVEVNTRLVLEKGLTLIGSSRSGSKDFQDVVDLYIQYPDI
    Newman          QMIDYISPEGSIALLGVSEFPVEVNTRLVLEKGLTLIGSSRSGSKDFQDVVDLYIQYPDI
    USA300_FPR3757  QMIDYISPEGSIALLGVSEFPVEVNTRLVLEKGLTLIGSSRSGSKDFQDVVDLYIQYPDI
                    ************************************************************

    COL             VDKLALLKGQEFEIATINDLTEAFEADLSTSWGKTVLKWIM
    N315            VDKLALLKGQEYEIATINDLTEAFEADLSTSWGKTVLKWIM
    NCTC8325        VDKLALLKGQEFEIATINDLTEAFEADLSTSWGKTVLKWIM
    Newman          VDKLALLKGQEFEIATINDLTEAFEADLSTSWGKTVLKWIM
    USA300_FPR3757  VDKLALLKGQEFEIATINDLTEAFEADLSTSWGKTVLKWIM
                    ***********:*****************************