From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001135000
  • symbol?: tarL
  • description?: teichoic acid biosynthesis protein

      descriptions from strain specific annotations:

    • teichoic acid biosynthesis protein
    • putative teichoic acid biosynthesis protein
    • CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase
    • putative CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase
    • Putative polyribitolphosphotransferase
    • CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase family protein
    • CDP-ribitol ribitolphosphotransferase
    • glycosyl/glycerophosphate transferase
    • teichoic acid biosynthesis protein, putative
    • teichoic acid biosynthesis protein B
  • strand?: +
  • coordinates?: 1404549..1406237
  • synteny block?: BlockID0006550
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0257
    08BA02176:
    C248_0245
    11819-97:
    MS7_0247
    71193:
    ST398NM01_0270
    ECT-R 2:
    ECTR2_218
    ED133:
    SAOV_0196
    ED98:
    SAAV_0225
    HO 5096 0412:
    SAEMRSA15_02160
    JH1:
    SaurJH1_0248
    JH9:
    SaurJH9_0242
    JKD6008:
    SAA6008_00231
    JKD6159:
    SAA6159_00234
    LGA251:
    SARLGA251_02210 (tarL)
    M013:
    M013TW_0238
    MRSA252:
    SAR0254
    MSHR1132:
    SAMSHR1132_02250
    MSSA476:
    SAS0234
    Mu3:
    SAHV_0256
    Mu50:
    SAV0257
    MW2:
    MW0233
    RF122:
    SAB0196
    ST398:
    SAPIG0270
    T0131:
    SAT0131_00250 (udk)
    TCH60:
    HMPREF0772_10245
    TW20:
    SATW20_02590 (tarL)
    USA300_TCH1516:
    USA300HOU_0268 (tagB2)
    VC40:
    SAVC_01025

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVKSKIYIDKIYWERVQLFVEGHSENLDLEDSNFVLRNLTETRTMKANDVKIDGNQFVCR
    N315            MVKSKIYIDKIYWERVQLFVEGHSENLDLEDSNFVLRNLTETRTMKANDVKIDGNQFVCR
    NCTC8325        MVKSKIYIDKIYWERVQLFVEGHSENLDLEDSNFVLRNLTETRTMKANDVKIDGNQFVCR
    Newman          MVKSKIYIDKIYWERVQLFVEGHSENLDLEDSNFVLRNLTETRTMKANDVKIDGNQFVCR
    USA300_FPR3757  MVKSKIYIDKIYWERVQLFVEGHSENLDLEDSNFVLRNLTETRTMKANDVKIDGNQFVCR
                    ************************************************************

    COL             FNVAILDNGYYLPEDKYLLVNEQELDYIAQLNPDVINDAYQNLKPEQEEEYNELETQNGK
    N315            FNVAILDNGYYLPEDKYLLVNEQELDYIAQLNPDVINDAYQNLKPEQEEEYNELETQNGK
    NCTC8325        FNVAILDNGYYLPEDKYLLVNEQELDYIAQLNPDVINDAYQNLKPEQEEEYNELETQNGK
    Newman          FNVAILDNGYYLPEDKYLLVNEQELDYIAQLNPDVINDAYQNLKPEQEEEYNELETQNGK
    USA300_FPR3757  FNVAILDNGYYLPEDKYLLVNEQELDYIAQLNPDVINDAYQNLKPEQEEEYNELETQNGK
                    ************************************************************

    COL             INFLLQTYLKEFRKGGISKKTVYTVTPEISSDVNEFVLDVVVTTPEVKSIYIVRKYKELR
    N315            INFLLQTYLKEFRKGGISKKTVYTVTPEISSDVNEFVLDVVVTTPEVKSIYIVRKYKELR
    NCTC8325        INFLLQTYLKEFRKGGISKKTVYTVTPEISSDVNEFVLDVVVTTPEVKSIYIVRKYKELR
    Newman          INFLLQTYLKEFRKGGISKKTVYTVTPEISSDVNEFVLDVVVTTPEVKSIYIVRKYKELR
    USA300_FPR3757  INFLLQTYLKEFRKGGISKKTVYTVTPEISSDVNEFVLDVVVTTPEVKSIYIVRKYKELR
                    ************************************************************

    COL             KYFRKQSFNTRQFIFKAIFNTTKFFHLKKGNTVLFTSDSRPTMSGNFEYIYNEMLRQNLD
    N315            KYFRKQSFNTRQFIFKAIFNTTKFFHLKKGNTVLFTSDSRPTMSGNFEYIYNEMLRQNLD
    NCTC8325        KYFRKQSFNTRQFIFKAIFNTTKFFHLKKGNTVLFTSDSRPTMSGNFEYIYNEMLRQNLD
    Newman          KYFRKQSFNTRQFIFKAIFNTTKFFHLKKGNTVLFTSDSRPTMSGNFEYIYNEMLRQNLD
    USA300_FPR3757  KYFRKQSFNTRQFIFKAIFNTTKFFHLKKGNTVLFTSDSRPTMSGNFEYIYNEMLRQNLD
                    ************************************************************

    COL             KKYDIHTVFKANITDRRGIIDKFRLPYLLGKADYIFVDDFHPLIYTVRFRRSQEVIQVWH
    N315            KKYDIHTVFKANITDRRGIIDKFRLPYLLGKADYIFVDDFHPLIYTVRFRRSQEVIQVWH
    NCTC8325        KKYDIHTVFKANITDRRGIIDKFRLPYLLGKADYIFVDDFHPLIYTVRFRRSQEVIQVWH
    Newman          KKYDIHTVFKANITDRRGIIDKFRLPYLLGKADYIFVDDFHPLIYTVRFRRSQEVIQVWH
    USA300_FPR3757  KKYDIHTVFKANITDRRGIIDKFRLPYLLGKADYIFVDDFHPLIYTVRFRRSQEVIQVWH
                    ************************************************************

    COL             AVGAFKTVGFSRTGKKGGPFIDSLNHRSYTKAYVSSETDIPFYAEAFGIKEKNVVPTGVP
    N315            AVGAFKTVGFSRTGKKGGPFIDSLNHRSYTKAYVSSETDIPFYAEAFGIKEKNVVPTGVP
    NCTC8325        AVGAFKTVGFSRTGKKGGPFIDSLNHRSYTKAYVSSETDIPFYAEAFGIKEKNVVPTGVP
    Newman          AVGAFKTVGFSRTGKKGGPFIDSLNHRSYTKAYVSSETDIPFYAEAFGIKEKNVVPTGVP
    USA300_FPR3757  AVGAFKTVGFSRTGKKGGPFIDSLNHRSYTKAYVSSETDIPFYAEAFGIKEKNVVPTGVP
                    ************************************************************

    COL             RTDVLFDEAYATQIKQEMEDELPIIKGKKVILFAPTFRGSGHGTAHYPFFKIDFERLARY
    N315            RTDVLFDEAYATQIKQEMEDELPIIKGKKVILFAPTFRGSGHGTAHYPFFKIDFERLARY
    NCTC8325        RTDVLFDEAYATQIKQEMEDELPIIKGKKVILFAPTFRGSGHGTAHYPFFKIDFERLARY
    Newman          RTDVLFDEAYATQIKQEMEDELPIIKGKKVILFAPTFRGSGHGTAHYPFFKIDFERLARY
    USA300_FPR3757  RTDVLFDEAYATQIKQEMEDELPIIKGKKVILFAPTFRGSGHGTAHYPFFKIDFERLARY
                    ************************************************************

    COL             CEKNNAVVLFKMHPFVKNRLNIADKHKQYFVDVSDFREVNDILFITDLLISDYSSLIYEY
    N315            CEKNNAVVLFKMHPFVKNRLNIADKHKQYFVDVSDFREVNDILFITDLLISDYSSLIYEY
    NCTC8325        CEKNNAVVLFKMHPFVKNRLNIADKHKQYFVDVSDFREVNDILFITDLLISDYSSLIYEY
    Newman          CEKNNAVVLFKMHPFVKNRLNIADKHKQYFVDVSDFREVNDILFITDLLISDYSSLIYEY
    USA300_FPR3757  CEKNNAVVLFKMHPFVKNRLNIADKHKQYFVDVSDFREVNDILFITDLLISDYSSLIYEY
                    ************************************************************

    COL             AVFKKPMIFYAFDLEDYITTRDFYEPYESFVPGKIVQSFDALMDALDNEDYEGEKVIPFL
    N315            AVFKKPMIFYAFDLEDYITTRDFYEPYESFVPGKIVQSFDALMDALDNEDYEGEKVIPFL
    NCTC8325        AVFKKPMIFYAFDLEDYITTRDFYEPYESFVPGKIVQSFDALMDALDNEDYEGEKVIPFL
    Newman          AVFKKPMIFYAFDLEDYITTRDFYEPYESFVPGKIVQSFDALMDALDNEDYEGEKVIPFL
    USA300_FPR3757  AVFKKPMIFYAFDLEDYITTRDFYEPYESFVPGKIVQSFDALMDALDNEDYEGEKVIPFL
                    ************************************************************

    COL             DKHFKYQDGRSSERLVRNLFGS
    N315            DKHFKYQDGRSSERLVRNLFGS
    NCTC8325        DKHFKYQDGRSSERLVRNLFGS
    Newman          DKHFKYQDGRSSERLVRNLFGS
    USA300_FPR3757  DKHFKYQDGRSSERLVRNLFGS
                    **********************