From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001136000
  • symbol?: tarS
  • description?: glycosyl transferase family protein

      descriptions from strain specific annotations:

    • glycosyl transferase family protein
    • glycosyl transferase, group 2 family protein
    • Glycosyl transferase family protein, putative
    • glycosyl transferase family 2 family protein
    • putative glycosyltransferase
    • glycosyl transferase 2 family protein
    • pseudogene
    • glycosyl transferase group 2 family protein
    • group 2 glycosyl transferase
  • strand?: +
  • coordinates?: 1406270..1407991
  • synteny block?: BlockID0006560
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0258
    08BA02176:
    C248_0246
    11819-97:
    MS7_0248
    71193:
    ST398NM01_0271
    ECT-R 2:
    ECTR2_219
    ED133:
    SAOV_0197
    ED98:
    SAAV_0226
    HO 5096 0412:
    SAEMRSA15_02170
    JH1:
    SaurJH1_0249
    JH9:
    SaurJH9_0243
    JKD6008:
    SAA6008_00232
    JKD6159:
    SAA6159_00235
    LGA251:
    SARLGA251_02220
    M013:
    M013TW_0239
    MRSA252:
    SAR0255
    MSHR1132:
    SAMSHR1132_02260
    MSSA476:
    SAS0235
    Mu3:
    SAHV_0257
    Mu50:
    SAV0258
    MW2:
    MW0234
    RF122:
    SAB0197
    ST398:
    SAPIG0271
    T0131:
    SAT0131_00251
    TCH60:
    HMPREF0772_10244
    TW20:
    SATW20_02600
    USA300_TCH1516:
    USA300HOU_0269
    VC40:
    SAVC_01030

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -MKFSVIVPTYNSEKYITELLNSLAKQDFPKTEFEVVVVDDCSTDQTLQIVEKYRNKLNL
    N315            MMKFSVIVPTYNSEKYITELLNSLAKQDFPKTEFEVVVVDDCSTDQTLQIVEKYRNKLNL
    NCTC8325        MMKFSVIVPTYNSEKYITELLNSLAKQDFPKTEFEVVVVDDCSTDQTLQIVEKYRNKLNL
    Newman          -MKFSVIVPTYNSEKYITELLNSLAKQDFPKTEFEVVVVDDCSTDQTLQIVEKYRNKLNL
    USA300_FPR3757  MMKFSVIVPTYNSEKYITELLNSLAKQDFPKTEFEVVVVDDCSTDQTLQIVEKYRNKLNL
                     ***********************************************************

    COL             KVSQLETNSGGPGKPRNVALKQAEGEFVLFVDSDDYINKETLKDAAAFIDEHHSDVLLIK
    N315            KVSQLETNSGGPGKPRNVALKQAEGEFVLFVDSDDYINKETLKDAAAFIDEHHSDVLLIK
    NCTC8325        KVSQLETNSGGPGKPRNVALKQAEGEFVLFVDSDDYINKETLKDAAAFIDEHHSDVLLIK
    Newman          KVSQLETNSGGPGKPRNVALKQAEGEFVLFVDSDDYINKETLKDAAAFIDEHHSDVLLIK
    USA300_FPR3757  KVSQLETNSGGPGKPRNVALKQAEGEFVLFVDSDDYINKETLKDAAAFIDEHHSDVLLIK
                    ************************************************************

    COL             MKGVNGRGVPQSMFKETAPEVTLLNSRIIYTLSPTKIYRTALLKDNDIYFPEELKSAEDQ
    N315            MKGVNGRGVPQSMFKETAPEVTLLNSRIIYTLSPTKIYRTALLKDNDIYFPEELKSAEDQ
    NCTC8325        MKGVNGRGVPQSMFKETAPEVTLLNSRIIYTLSPTKIYRTALLKDNDIYFPEELKSAEDQ
    Newman          MKGVNGRGVPQSMFKETAPEVTLLNSRIIYTLSPTKIYRTALLKDNDIYFPEELKSAEDQ
    USA300_FPR3757  MKGVNGRGVPQSMFKETAPEVTLLNSRIIYTLSPTKIYRTALLKDNDIYFPEELKSAEDQ
                    ************************************************************

    COL             LFTMKAYLNANRISVLSDKAYYYATKREGEHMSSAYVSPEDFYEVMRLIAVEILNTDLEE
    N315            LFTMKAYLNANRISVLSDKAYYYATKREGEHMSSAYVSPEDFYEVMRLIAVEILNADLEE
    NCTC8325        LFTMKAYLNANRISVLSDKAYYYATKREGEHMSSAYVSPEDFYEVMRLIAVEILNADLEE
    Newman          LFTMKAYLNANRISVLSDKAYYYATKREGEHMSSAYVSPEDFYEVMRLIAVEILNTDLEE
    USA300_FPR3757  LFTMKAYLNANRISVLSDKAYYYATKREGEHMSSAYVSPEDFYEVMRLIAVEILNADLEE
                    *******************************************************:****

    COL             AHKNQILAEFLNRHFSFSRTNGFSLKVKLEDQPQWINALGDFIQAVPERVDALVMSKLRP
    N315            AHKDQILAEFLNRHFSFSRTNGFSLKVKLEEQPQWINALGDFIQAVPERVDALVMSKLRP
    NCTC8325        AHKNQILAEFLNRHFSFSRTNGFSLKVKLEDQPQWINALGDFIQAVPERVDALVMSKLRP
    Newman          AHKNQILAEFLNRHFSFSRTNGFSLKVKLEDQPQWINALGDFIQAVPERVDALVMSKLRP
    USA300_FPR3757  AHKNQILAEFLNRHFSFSRTNGFSLKVKLEDQPQWINALGDFIQAVPERVDALVMSKLRP
                    ***:**************************:*****************************

    COL             LLHYARAKDIDNYRTVEESYRQGQYYRFDIVDGKLNIQFNEGEPYFKGIDIAKPKVKMTA
    N315            LLHYARAKDIDNYRTVEESYRQGQYYRFDIVDGKLNIQFNEGEPYFEGIDIAKPKVKMTA
    NCTC8325        LLHYARAKDIDNYRTVEESYRQGQYYRFDIVDGKLNIQFNEGEPYFKGIDIAKPKVKMTA
    Newman          LLHYARAKDIDNYRTVEESYRQGQYYRFDIVDGKLNIQFNEGEPYFKGIDIAKPKVKMTA
    USA300_FPR3757  LLHYARAKDIDNYRTVEESYRQGQYYRFDIVDGKLNIQFNEGEPYFKGIDIAKPKVKMTA
                    **********************************************:*************

    COL             FKFDNHKIVTELTLNEFMIGEGHYDVRLKLHSRNKKHTMYVPLSVNANKQYRFNIMLEDI
    N315            FKFDNHKIVTELTLNEFMIGEGHYDVRLKLHSRNKKHTMYVPLSVNANKQYRFNIMLEDI
    NCTC8325        FKFDNHKIVTELTLNEFMIGEGHYDVRLKLHSRNKKHTMYVPLSVNANKQYRFNIMLEDI
    Newman          FKFDNHKIVTELTLNEFMIGEGHYDVRLKLHSRNKKHTMYVPLSVNANKQYRFNIMLEDI
    USA300_FPR3757  FKFDNHKIVTELTLNEFMIGEGHYDVRLKLHSRNKKHTMYVPLSVNANKQYRFNIMLEDI
                    ************************************************************

    COL             KAYLPKEKIWDVFLEVQIGTEVFEVRVGNQRNKYAYTAETSALIHLNNDFYRLTPYFTKD
    N315            KAYLPKEKIWDVFLEVQIGTEVFEVRVGNQRNKYAYTAETSALIHLNNDFYRLTPYFTKD
    NCTC8325        KAYLPKEKIWDVFLEVQIGTEVFEVRVGNQRNKYAYTAETSALIHLNNDFYRLTPYFTKD
    Newman          KAYLPKEKIWDVFLEVQIGTEVFEVRVGNQRNKYAYTAETSALIHLNNDFYRLTPYFTKD
    USA300_FPR3757  KAYLPKEKIWDVFLEVQIGTEVFEVRVGNQRNKYAYTAETSALIHLNNDFYRLTPYFTKD
                    ************************************************************

    COL             FNNISLYFTAITLTDSISLKLKGKNKIILTGLDRGYVFEEGMASVVLKDDMVMGMLSQTS
    N315            FNNISLYFTAITLTDSISMKLKGKNKIILTGLDRGYVFEEGMASVVLKDDMIMGMLSQTS
    NCTC8325        FNNISLYFTAITLTDSISLKLKGKNKIILTGLDRGYVFEEGMASVVLKDDMVMGMLSQTS
    Newman          FNNISLYFTAITLTDSISLKLKGKNKIILTGLDRGYVFEEGMASVVLKDDMVMGMLSQTS
    USA300_FPR3757  FNNISLYFTAITLTDSISLKLKGKNKIILTGLDRGYVFEEGMASVVLKDDMVMGMLSQTS
                    ******************:********************************:********

    COL             ENEVQILLSKDIKKRDFKNIVKLNTAHITYPLNK
    N315            ENEVEILLSKDIKKRDFKNIVKLNTAHMTYSLK-
    NCTC8325        ENEVQILLSKDIKKRDFKNIVKLNTAHITYPLNK
    Newman          ENEVQILLSKDIKKRDFKNIVKLNTAHITYPLNK
    USA300_FPR3757  ENEVQILLSKDIKKRDFKNIVKLNTAHITYPLNK
                    ****:**********************:**.*: