Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001139000
  • symbol?: lytS
  • description?: two-component sensor histidine kinase

      descriptions from strain specific annotations:

    • two-component sensor histidine kinase
    • signal transduction histidine kinase LytS
    • 5TM Receptors of the LytS-YhcK type transmembrane region
    • sensor histidine kinase LytS
    • Autolysis histidine kinase LytS
    • sensor protein lytS
    • autolysin sensor histidine kinase
    • autolysin sensor kinase
    • histidine kinase-, DNA gyrase B-, and HSP90-like ATPase family protein
    • autolysin sensor kinase protein
  • strand?: +
  • coordinates?: 1410043..1411797
  • synteny block?: BlockID0006590
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0245 (lytS)
    N315:
    SA0250 (lytS)
    NCTC8325:
    Newman:
    NWMN_0194 (lytS)
    USA300_FPR3757:
    04-02981:
    SA2981_0260 (lytS)
    08BA02176:
    C248_0248 (lytS)
    11819-97:
    MS7_0250
    71193:
    ST398NM01_0273
    ECT-R 2:
    ECTR2_221
    ED133:
    SAOV_0200
    ED98:
    SAAV_0228 (lytS)
    HO 5096 0412:
    SAEMRSA15_02190 (lytS)
    JH1:
    SaurJH1_0251
    JH9:
    SaurJH9_0245
    JKD6008:
    SAA6008_00234 (lytS)
    JKD6159:
    SAA6159_00237 (lytS)
    LGA251:
    SARLGA251_02240 (lytS)
    M013:
    M013TW_0241
    MRSA252:
    SAR0257 (lytS)
    MSHR1132:
    SAMSHR1132_02270
    MSSA476:
    SAS0237
    Mu3:
    SAHV_0259 (lytS)
    Mu50:
    SAV0260 (lytS)
    MW2:
    MW0236 (lytS)
    RF122:
    SAB0199 (lytS)
    ST398:
    SAPIG0273
    T0131:
    SAT0131_00253
    TCH60:
    HMPREF0772_10242 (lytS)
    TW20:
    SATW20_02620 (lytS)
    USA300_TCH1516:
    USA300HOU_0271 (lytS)
    VC40:
    SAVC_01040

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLSLTMLLLERVGLIIILAYVLMNIPYFKNLMNRRRTWKARWQLCIIFSLFALMSNLTGI
    N315            MLSLTMLLLERVGLIIILAYVLMNIPYFKNLMNRRRTWKARWQLCIIFSLFALMSNLTGI
    NCTC8325        -----MLLLERVGLIIILAYVLMNIPYFKNLMNRRRTWKARWQLCIIFSLFALMSNLTGI
    Newman          MLSLTMLLLERVGLIIILAYVLMNIPYFKNLMNRRRTWKARWQLCIIFSLFALMSNLTGI
    USA300_FPR3757  -----MLLLERVGLIIILAYVLMNIPYFKNLMNRRRTWKARWQLCIIFSLFALMSNLTGI
                         *******************************************************

    COL             VIDHQHSLSGSVYFRLDDDVSLANTRVLTIGVAGLVGGPFVGLFVGVISGIFRVYMGGAD
    N315            VIDHQHSLSGSVYFRLDDDVSLANTRVLTIGVAGLVGGPFVGLFVGVISGIFRVYMGGAD
    NCTC8325        VIDHQHSLSGSVYFRLDDDVSLANTRVLTIGVAGLVGGPFVGLFVGVISGIFRVYMGGAD
    Newman          VIDHQHSLSGSVYFRLDDDVSLANTRVLTIGVAGLVGGPFVGLFVGVISGIFRVYMGGAD
    USA300_FPR3757  VIDHQHSLSGSVYFRLDDDVSLANTRVLTIGVAGLVGGPFVGLFVGVISGIFRVYMGGAD
                    ************************************************************

    COL             AQVYLISSIFIGIIAGYFGLQAQRRKRYPSIAKSAMIGIVMEMIQMLSILTFSHDKAYAV
    N315            AQVYLISSIFIGIIAGYFGLQAQRRKRYPSIAKSAMIGIVMEMIQMLSILTFSHDKAYAV
    NCTC8325        AQVYLISSIFIGIIAGYFGLQAQRRKRYPSIAKSAMIGIVMEMIQMLSILTFSHDKAYAV
    Newman          AQVYLISSIFIGIIAGYFGLQAQRRKRYPSIAKSAMIGIVMEMIQMLSILTFSHDKAYAV
    USA300_FPR3757  AQVYLISSIFIGIIAGYFGLQAQRRKRYPSIAKSAMIGIVMEMIQMLSILTFSHDKAYAV
                    ************************************************************

    COL             DLISLIALPMIIVNSVGTAIFMSIIISTLKQEEQMKAVQTHDVLQLMNQTLPYFKEGLNR
    N315            DLISLIALPMIIVNSVGTAIFMSIIISTLKQEEQMKAVQTHDVLQLMNQTLPYFKEGLNR
    NCTC8325        DLISLIALPMIIVNSVGTAIFMSIIISTLKQEEQMKAVQTHDVLQLMNQTLPYFKEGLNR
    Newman          DLISLIALPMIIVNSVGTAIFMSIIISTLKQEEQMKAVQTHDVLQLMNQTLPYFKEGLNR
    USA300_FPR3757  DLISLIALPMIIVNSVGTAIFMSIIISTLKQEEQMKAVQTHDVLQLMNQTLPYFKEGLNR
                    ************************************************************

    COL             ESAQQIAMIIKNLMKVSAVAITSKNEILSHVGAGSDHHIPTNEILTSLSKDVLKSGKLKE
    N315            ESAQQIAMIIKNLMKVSAVAITSKNEILSHVGAGSDHHIPTNEILTSLSKDVLKSGKLKE
    NCTC8325        ESAQQIAMIIKNLMKVSAVAITSKNEILSHVGAGSDHHIPTNEILTSLSKDVLKSGKLKE
    Newman          ESAQQIAMIIKNLMKVSAVAITSKNEILSHVGAGSDHHIPTNEILTSLSKDVLKSGKLKE
    USA300_FPR3757  ESAQQIAMIIKNLMKVSAVAITSKNEILSHVGAGSDHHIPTNEILTSLSKDVLKSGKLKE
                    ************************************************************

    COL             VHTKEEIGCSHPNCPLRAAIVIPLEMHGSIVGTLKMYFTNPNDLTFVERQLAEGLANIFS
    N315            VHTKEEIGCSHPNCPLRAAIVIPLEMHGSIVGTLKMYFTNPNDLTFVERQLAEGLANIFS
    NCTC8325        VHTKEEIGCSHPNCPLRAAIVIPLEMHGSIVGTLKMYFTNPNDLTFVERQLAEGLANIFS
    Newman          VHTKEEIGCSHPNCPLRAAIVIPLEMHGSIVGTLKMYFTNPNDLTFVERQLAEGLANIFS
    USA300_FPR3757  VHTKEEIGCSHPNCPLRAAIVIPLEMHGSIVGTLKMYFTNPNDLTFVERQLAEGLANIFS
                    ************************************************************

    COL             SQIELGEAETQSKLLKDAEIKSLQAQVSPHFFFNSINTISALVRINSEKARELLLELSYF
    N315            SQIELGEAETQSKLLKDAEIKSLQAQVSPHFFFNSINTISALVRINSEKARELLLELSYF
    NCTC8325        SQIELGEAETQSKLLKDAEIKSLQAQVSPHFFFNSINTISALVRINSEKARELLLELSYF
    Newman          SQIELGEAETQSKLLKDAEIKSLQAQVSPHFFFNSINTISALVRINSEKARELLLELSYF
    USA300_FPR3757  SQIELGEAETQSKLLKDAEIKSLQAQVSPHFFFNSINTISALVRINSEKARELLLELSYF
                    ************************************************************

    COL             FRANLQGSKQHTITLDKELSQVRAYLSLEQARYPGRFNININVEDKYRDVLVPPFLIQIL
    N315            FRANLQGSKQHTITLDKELSQVRAYLSLEQARYPGRFNININVEDKYRDVLVPPFLIQIL
    NCTC8325        FRANLQGSKQHTITLDKELSQVRAYLSLEQARYPGRFNININVEDKYRDVLVPPFLIQIL
    Newman          FRANLQGSKQHTITLDKELSQVRAYLSLEQARYPGRFNININVEDKYRDVLVPPFLIQIL
    USA300_FPR3757  FRANLQGSKQHTITLDKELSQVRAYLSLEQARYPGRFNININVEDKYRDVLVPPFLIQIL
                    ************************************************************

    COL             VENAIKHAFTNRKQGNDIDVSVIKETATHVRIIVQDNGQGISKDKMHLLGETSVESESGT
    N315            VENAIKHAFTNRKQGNDIDVSVIKETATHVRIIVQDNGQGISKDKMHLLGETSVESESGT
    NCTC8325        VENAIKHAFTNRKQGNDIDVSVIKETATHVRIIVQDNGQGISKDKMHLLGETSVESESGT
    Newman          VENAIKHAFTNRKQGNDIDVSVIKETATHVRIIVQDNGQGISKDKMHLLGETSVESESGT
    USA300_FPR3757  VENAIKHAFTNRKQGNDIDVSVIKETATHVRIIVQDNGQGISKDKMHLLGETSVESESGT
                    ************************************************************

    COL             GSALENLNLRLKGLFGKSAALQFESTSSGTTFWCVLPYERQEEE
    N315            GSALENLNLRLKGLFGKSAALQFESTSSGTTFWCVLPYERQEEE
    NCTC8325        GSALENLNLRLKGLFGKSAALQFESTSSGTTFWCVLPYERQEEE
    Newman          GSALENLNLRLKGLFGKSAALQFESTSSGTTFWCVLPYERQEEE
    USA300_FPR3757  GSALENLNLRLKGLFGKSAALQFESTSSGTTFWCVLPYERQEEE
                    ********************************************