From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001140000
  • symbol?: lytR
  • description?: two-component response regulator

      descriptions from strain specific annotations:

    • two-component response regulator
    • DNA-binding response regulator
    • sensory transduction protein lytR
    • sensory transduction protein lytT
    • autolysin response regulator protein
    • Autolysis response regulater LytR
    • response regulator LytR
    • two component transcriptional regulator, LytR
  • strand?: +
  • coordinates?: 1411800..1412540
  • synteny block?: BlockID0006600
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0246 (lytR)
    N315:
    SA0251 (lytR)
    NCTC8325:
    Newman:
    NWMN_0195 (lytR)
    USA300_FPR3757:
    04-02981:
    SA2981_0261 (lytR)
    08BA02176:
    C248_0249 (lytR)
    11819-97:
    MS7_0251
    71193:
    ST398NM01_0274
    ECT-R 2:
    ECTR2_222
    ED133:
    SAOV_0201
    ED98:
    SAAV_0229 (lytR)
    HO 5096 0412:
    SAEMRSA15_02200 (lytR)
    JH1:
    SaurJH1_0252
    JH9:
    SaurJH9_0246
    JKD6008:
    SAA6008_00235 (lytR)
    JKD6159:
    SAA6159_00238 (lytR)
    LGA251:
    SARLGA251_02250 (lytR)
    M013:
    M013TW_0242
    MRSA252:
    SAR0258 (lytR)
    MSHR1132:
    SAMSHR1132_02280
    MSSA476:
    SAS0238
    Mu3:
    SAHV_0260 (lytR)
    Mu50:
    SAV0261 (lytR)
    MW2:
    MW0237 (lytR)
    RF122:
    SAB0200 (lytR)
    ST398:
    SAPIG0274
    T0131:
    SAT0131_00254
    TCH60:
    HMPREF0772_10241 (lytR)
    TW20:
    SATW20_02630 (lytR)
    USA300_TCH1516:
    USA300HOU_0272 (lytR)
    VC40:
    SAVC_01045

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKALIIDDEPLARNELTYLLNEIGGFEEINEAENVKETLEALLINQYDIIFLDVNLMDEN
    N315            MKALIIDDEPLARNELTYLLNEIGGFEEINEAENVKETLEALLINQYDIIFLDVNLMDEN
    NCTC8325        MKALIIDDEPLARNELTYLLNEIGGFEEINEAENVKETLEALLINQYDIIFLDVNLMDEN
    Newman          MKALIIDDEPLARNELTYLLNEIGGFEEINEAENVKETLEALLINQYDIIFLDVNLMDEN
    USA300_FPR3757  MKALIIDDEPLARNELTYLLNEIGGFEEINEAENVKETLEALLINQYDIIFLDVNLMDEN
                    ************************************************************

    COL             GIELGAKIQKMKEPPAIIFATAHDQYAVQAFELNATDYILKPFGQKRIEQAVNKVRATKA
    N315            GIELGAKIQKMKEPPAIIFATAHDQYAVQAFELNATDYILKPFGQKRIEQAVNKVRATKA
    NCTC8325        GIELGAKIQKMKEPPAIIFATAHDQYAVQAFELNATDYILKPFGQKRIEQAVNKVRATKA
    Newman          GIELGAKIQKMKEPPAIIFATAHDQYAVQAFELNATDYILKPFGQKRIEQAVNKVRATKA
    USA300_FPR3757  GIELGAKIQKMKEPPAIIFATAHDQYAVQAFELNATDYILKPFGQKRIEQAVNKVRATKA
                    ************************************************************

    COL             KDDNNASAIANDMSANFDQSLPVEIDDKIHMLKQQNIIGIGTHNGITTIHTTNHKYETTE
    N315            KDDNNASAIANDMSANFDQSLPVEIDDKIHMLKQQNIIGIGTHNGITTIHTTNHKYETTE
    NCTC8325        KDDNNASAIANDMSANFDQSLPVEIDDKIHMLKQQNIIGIGTHNGITTIHTTNHKYETTE
    Newman          KDDNNASAIANDMSANFDQSLPVEIDDKIHMLKQQNIIGIGTHNGITTIHTTNHKYETTE
    USA300_FPR3757  KDDNNASAIANDMSANFDQSLPVEIDDKIHMLKQQNIIGIGTHNGITTIHTTNHKYETTE
                    ************************************************************

    COL             PLNRYEKRLNPTYFIRIHRSYIINTKHIKEVQQWFNYTYMVILTNGVKMQVGRSFMKDFK
    N315            PLNRYEKRLNPTYFIRIHRSYIINTKHIKEVQQWFNYTYMVILTNGVKMQVGRSFMKDFK
    NCTC8325        PLNRYEKRLNPTYFIRIHRSYIINTKHIKEVQQWFNYTYMVILTNGVKMQVGRSFMKDFK
    Newman          PLNRYEKRLNPTYFIRIHRSYIINTKHIKEVQQWFNYTYMVILTNGVKMQVGRSFMKDFK
    USA300_FPR3757  PLNRYEKRLNPTYFIRIHRSYIINTKHIKEVQQWFNYTYMVILTNGVKMQVGRSFMKDFK
                    ************************************************************

    COL             ASIGLL
    N315            ASIGLL
    NCTC8325        ASIGLL
    Newman          ASIGLL
    USA300_FPR3757  ASIGLL
                    ******