From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001141000
  • symbol?: lrgA
  • description?: murein hydrolase regulator LrgA

      descriptions from strain specific annotations:

    • murein hydrolase regulator LrgA
    • holin-like protein
    • LrgA family protein
    • holin-like protein LrgA
    • Antiholin-like protein LrgA
    • murein hydrolase exporter
  • strand?: +
  • coordinates?: 1412653..1413096
  • synteny block?: BlockID0006610
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0247 (lrgA)
    N315:
    SA0252 (lrgA)
    NCTC8325:
    Newman:
    NWMN_0196 (lrgA)
    USA300_FPR3757:
    04-02981:
    SA2981_0262 (lrgA)
    08BA02176:
    C248_0250 (lrgA)
    11819-97:
    MS7_0252
    71193:
    ST398NM01_0275
    ECT-R 2:
    ECTR2_223
    ED133:
    SAOV_0202
    ED98:
    SAAV_0230 (lrgA)
    HO 5096 0412:
    SAEMRSA15_02210 (lrgA)
    JH1:
    SaurJH1_0253
    JH9:
    SaurJH9_0247
    JKD6008:
    SAA6008_00236 (lrgA)
    JKD6159:
    SAA6159_00239 (lrgA)
    LGA251:
    SARLGA251_02260 (lrgA)
    M013:
    M013TW_0243
    MRSA252:
    SAR0259 (lrgA)
    MSHR1132:
    SAMSHR1132_02290
    MSSA476:
    SAS0239
    Mu3:
    SAHV_0261 (lrgA)
    Mu50:
    SAV0262 (lrgA)
    MW2:
    MW0238 (lrgA)
    RF122:
    SAB0201 (lrgA)
    ST398:
    SAPIG0275
    T0131:
    SAT0131_00255
    TCH60:
    HMPREF0772_10240 (lrgA)
    TW20:
    SATW20_02640 (lrgA)
    USA300_TCH1516:
    USA300HOU_0273 (lrgA)
    VC40:
    SAVC_01050

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVVKQQKDASKPAHFFHQVIVIALVLFVSKIIESFMPIPMPASVIGLVLLFVLLCTGAVK
    N315            --MKQQKDASKPAHFFHQVIVIALVLFVSKIIESFMPIPMPASVIGLVLLFVLLCTGAVK
    NCTC8325        MVVKQQKDASKPAHFFHQVIVIALVLFVSKIIESFMPIPMPASVIGLVLLFVLLCTGAVK
    Newman          MVVKQQKDASKPAHFFHQVIVIALVLFVSKIIESFMPIPMPASVIGLVLLFVLLCTGAVK
    USA300_FPR3757  MVVKQQKDASKPAHFFHQVIVIALVLFVSKIIESFMPIPMPASVIGLVLLFVLLCTGAVK
                      :*********************************************************

    COL             LGEVEKVGTTLTNNIGLLFVPAGISVVNSLGVISQAPFLIIGLIIVSTILLLICTGYVTQ
    N315            LGEVEKVGTTLTNNIGLLFVPAGISVVNSLGVISQAPFLIIGLIIVSTILLLICTGYVTQ
    NCTC8325        LGEVEKVGTTLTNNIGLLFVPAGISVVNSLGVISQAPFLIIGLIIVSTILLLICTGYVTQ
    Newman          LGEVEKVGTTLTNNIGLLFVPAGISVVNSLGVISQAPFLIIGLIIVSTILLLICTGYVTQ
    USA300_FPR3757  LGEVEKVGTTLTNNIGLLFVPAGISVVNSLGVISQAPFLIIGLIIVSTILLLICTGYVTQ
                    ************************************************************

    COL             IIMKVTSRSKGDKVTKKIKIEEAQAHD
    N315            IIMKVTSRSKGDKVTKKIKIEEAQAHD
    NCTC8325        IIMKVTSRSKGDKVTKKIKIEEAQAHD
    Newman          IIMKVTSRSKGDKVTKKIKIEEAQAHD
    USA300_FPR3757  IIMKVTSRSKGDKVTKKIKIEEAQAHD
                    ***************************