From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001142000
  • symbol?: lrgB
  • description?: antiholin-like protein LrgB

      descriptions from strain specific annotations:

    • antiholin-like protein LrgB
    • LrgA-associated membrane protein LrgB
    • lrgB-like family protein
    • murein hydrolase export regulator
    • murein hydrolase regulator LrgB
  • strand?: +
  • coordinates?: 1413089..1413790
  • synteny block?: BlockID0006620
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0248 (lrgB)
    N315:
    SA0253 (lrgB)
    NCTC8325:
    Newman:
    NWMN_0197 (lrgB)
    USA300_FPR3757:
    04-02981:
    SA2981_0263 (lrgB)
    08BA02176:
    C248_0251 (lrgB)
    11819-97:
    MS7_0253 (lrgB)
    71193:
    ST398NM01_0276
    ECT-R 2:
    ECTR2_224
    ED133:
    SAOV_0203
    ED98:
    SAAV_0231 (lrgB)
    HO 5096 0412:
    SAEMRSA15_02220 (lrgB)
    JH1:
    SaurJH1_0254
    JH9:
    SaurJH9_0248
    JKD6008:
    SAA6008_00237 (lrgB)
    JKD6159:
    SAA6159_00240 (lrgB)
    LGA251:
    SARLGA251_02270 (lrgB)
    M013:
    M013TW_0244
    MRSA252:
    SAR0260 (lrgB)
    MSHR1132:
    SAMSHR1132_02300
    MSSA476:
    SAS0240
    Mu3:
    SAHV_0262 (lrgB)
    Mu50:
    SAV0263 (lrgB)
    MW2:
    MW0239 (lrgB)
    RF122:
    SAB0202 (lrgB)
    ST398:
    SAPIG0276
    T0131:
    SAT0131_00256
    TCH60:
    HMPREF0772_10239 (lrgB)
    TW20:
    SATW20_02650 (lrgB)
    USA300_TCH1516:
    USA300HOU_0274 (lrgB)
    VC40:
    SAVC_01055

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MINHLALNTPYFGILLSVIPFFLATILFEKTNRFFLFAPLFVSMVFGVAFLYLTGIPYKT
    N315            MINHLALNTPYFGILLSVIPFFLATILFEKTNRFFLFAPLFVSMVFGVAFLYLTGIPYKT
    NCTC8325        MINHLALNTPYFGILLSVIPFFLATILFEKTNRFFLFAPLFVSMVFGVAFLYLTGIPYKT
    Newman          MINHLALNTPYFGILLSVIPFFLATILFEKTNRFFLFAPLFVSMVFGVAFLYLTGIPYKT
    USA300_FPR3757  MINHLALNTPYFGILLSVIPFFLATILFEKTNRFFLFAPLFVSMVFGVAFLYLTGIPYKT
                    ************************************************************

    COL             YKIGGDIIYFFLEPATICFAIPLYKKREVLVKHWHRIIGGIGIGTVVALLIILTFAKLAQ
    N315            YKIGGDIIYFFLEPATICFAIPLYKKREVLVKHWHRIIGGIGIGTVVALLIILTFAKLAQ
    NCTC8325        YKIGGDIIYFFLEPATICFAIPLYKKREVLVKHWHRIIGGIGIGTVVALLIILTFAKLAQ
    Newman          YKIGGDIIYFFLEPATICFAIPLYKKREVLVKHWHRIIGGIGIGTVVALLIILTFAKLAQ
    USA300_FPR3757  YKIGGDIIYFFLEPATICFAIPLYKKREVLVKHWHRIIGGIGIGTVVALLIILTFAKLAQ
                    ************************************************************

    COL             FANDVILSMLPQAATTAIALPVSAGIGGIKELTSLAVILNGVIIYALGNKFLKLFRITNP
    N315            FANDVILSMLPQAATTAIALPVSAGIGGIKELTSLAVILNGVIIYALGNKFLKLFRITNP
    NCTC8325        FANDVILSMLPQAATTAIALPVSAGIGGIKELTSLAVILNGVIIYALGNKFLKLFRITNP
    Newman          FANDVILSMLPQAATTAIALPVSAGIGGIKELTSLAVILNGVIIYALGNKFLKLFRITNP
    USA300_FPR3757  FANDVILSMLPQAATTAIALPVSAGIGGIKELTSLAVILNGVIIYALGNKFLKLFRITNP
                    ************************************************************

    COL             IARGLALGTSGHTLGVAPAKELGPVEESMASIALVLVGVVVVAVVPVFVAIFF
    N315            IARGLALGTSGHTLGVAPAKELGPVEESMASIALVLVGVVVVAVVPVFVAIFF
    NCTC8325        IARGLALGTSGHTLGVAPAKELGPVEESMASIALVLVGVVVVAVVPVFVAIFF
    Newman          IARGLALGTSGHTLGVAPAKELGPVEESMASIALVLVGVVVVAVVPVFVAIFF
    USA300_FPR3757  IARGLALGTSGHTLGVAPAKELGPVEESMASIALVLVGVVVVAVVPVFVAIFF
                    *****************************************************