From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN001158000
  • symbol?:
  • description?: NADH dehydrogenase subunit

      descriptions from strain specific annotations:

    • NADH dehydrogenase subunit
    • Truncated NADH dehydrogenase subunit
    • NADH dehydrogenase subunit, truncated
  • strand?: +
  • coordinates?: 1429763..1429981
  • synteny block?: BlockID0006780
  • occurrence?: in 56% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0272
    08BA02176:
    C248_0262
    11819-97:
    MS7_0262
    71193:
    ST398NM01_0287
    ECT-R 2:
    ECTR2_233
    ED133:
    SAOV_0213
    ED98:
    SAAV_0240
    HO 5096 0412:
    JH1:
    SaurJH1_0263
    JH9:
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    M013TW_0253
    MRSA252:
    SAR0269a
    MSHR1132:
    MSSA476:
    SAS0248a
    Mu3:
    Mu50:
    SAV0272
    MW2:
    MW0248
    RF122:
    ST398:
    SAPIG0287
    T0131:
    TCH60:
    HMPREF0772_10228
    TW20:
    USA300_TCH1516:
    USA300HOU_0284
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRRENILLRLIPFNDYDNKNFKMFIVIKNTKVIILKNKIFVFEQSIKKHNEMMYIELCD
    NCTC8325        MRRENILLRLIPFNDYDNKNFKMFIVIKNTKVIILKNKIFVFEQSIKKHNEMMYIELCD
                    ***********************************************************