From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001159000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 1430037..1430429
  • synteny block?: BlockID0006790
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0273
    08BA02176:
    C248_0263
    11819-97:
    MS7_0263
    71193:
    ST398NM01_0288
    ECT-R 2:
    ECTR2_234
    ED133:
    SAOV_0214
    ED98:
    SAAV_0241
    HO 5096 0412:
    SAEMRSA15_02320
    JH1:
    SaurJH1_0264
    JH9:
    SaurJH9_0257
    JKD6008:
    SAA6008_00247
    JKD6159:
    SAA6159_00251
    LGA251:
    SARLGA251_02370
    M013:
    M013TW_0254
    MRSA252:
    SAR0270
    MSHR1132:
    SAMSHR1132_02390
    MSSA476:
    SAS0249
    Mu3:
    SAHV_0271
    Mu50:
    SAV0273
    MW2:
    MW0249
    RF122:
    SAB0212
    ST398:
    SAPIG0288
    T0131:
    SAT0131_00267 (mnmA)
    TCH60:
    HMPREF0772_10227
    TW20:
    SATW20_02750
    USA300_TCH1516:
    USA300HOU_0285
    VC40:
    SAVC_01105

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQFKLKEEEIISFLELKYPEKEFEYGRLLVGQHKRDDLDVYYFGDTFLMCTIISFKTFEI
    N315            MQFKLKEEEIISFLELKYPEKEFEYGRLLVGQHKRDDLDVYYFGDTFLMCTIISFKTFEI
    NCTC8325        MQFKLKEEEIISFLELKYPEKEFEYGRLLVGQHKRDDLDVYYFGDTFLMCTIISFKTFEI
    Newman          MQFKLKEEEIISFLELKYPEKEFEYGRLLVGQHKRDDLDVYYFGDTFLMCTIISFKTFEI
    USA300_FPR3757  MQFKLKEEEIISFLELKYPEKEFEYGRLLVGQHKRDDLDVYYFGDTFLMCTIISFKTFEI
                    ************************************************************

    COL             KETVELSYDAVNRIVLKDGWLFRKMRIETMQKVLKYGTSKLMLTDFQKENYNKYIQGQKQ
    N315            KETVELSYDAVNRIVLKDGWLFRKMRIETMQKVLKYGTSKLMLTDFQKENYNKYIQGQKQ
    NCTC8325        KETVELSYDAVNRIVLKDGWLFRKMRIETMQKVLKYGTSKLMLTDFQKENYNKYIQGQKQ
    Newman          KETVELSYDAVNRIVLKDGWLFRKMRIETMQKVLKYGTSKLMLTDFQKENYNKYIQGQKQ
    USA300_FPR3757  KETVELSYDAVNRIVLKDGWLFRKMRIETMQKVLKYGTSKLMLTDFQKENYNKYIQGQKQ
                    ************************************************************

    COL             RVIFENGHFV
    N315            RVIFENGHFV
    NCTC8325        RVIFENGHFV
    Newman          RVIFENGHFV
    USA300_FPR3757  RVIFENGHFV
                    **********