From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001162000
  • symbol?:
  • description?: choloylglycine hydrolase

      descriptions from strain specific annotations:

    • choloylglycine hydrolase
    • choloylglycine hydrolase family protein
    • Choloylglycine hydrolase-like protein
    • C59 family penicillin amidase
    • linear amide C-N hydrolase, choloylglycine hydrolase family protein
    • linear amide C-N hydrolases, choloylglycine hydrolase family protein
    • Penicillin amidase
    • penicillin amidase V
    • penicillin-related choloylglycine hydrolase
    • penicillin V acylase
    • putative choloylglycine hydrolase
  • strand?: +
  • coordinates?: 1432935..1433936
  • synteny block?: BlockID0006820
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0275
    08BA02176:
    C248_0265
    11819-97:
    MS7_0266
    71193:
    ST398NM01_0290
    ECT-R 2:
    ECTR2_236
    ED133:
    SAOV_0216
    ED98:
    SAAV_0243
    HO 5096 0412:
    SAEMRSA15_02340
    JH1:
    SaurJH1_0266
    JH9:
    SaurJH9_0259
    JKD6008:
    SAA6008_00249
    JKD6159:
    SAA6159_00253
    LGA251:
    SARLGA251_02390
    M013:
    M013TW_0256
    MRSA252:
    SAR0272
    MSHR1132:
    SAMSHR1132_02410
    MSSA476:
    SAS0251
    Mu3:
    SAHV_0273
    Mu50:
    SAV0275
    MW2:
    MW0251
    RF122:
    SAB0214
    ST398:
    SAPIG0290
    T0131:
    SAT0131_00270
    TCH60:
    HMPREF0772_10225
    TW20:
    SATW20_02770
    USA300_TCH1516:
    USA300HOU_0288
    VC40:
    SAVC_01120

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MCTGFTIQTLNNQVLLGRTMDYDYPLDGSPAVTPRNYRWKSRTGTTGQTQYGFIGTGTDM
    N315            MCTGFTIQTLNNQVLLGRTMDYDYPLDGSPAVTPRNYRWTSRTGTTGQTQYGFIGTGTDM
    NCTC8325        MCTGFTIQTLNNQVLLGRTMDYDYPLDGSPAVTPRNYRWKSCTGTTGQTQYGFIGTGTDM
    Newman          MCTGFTIQTLNNQVLLGRTMDYDYPLDGSPAVTPRNYRWKSRTGTTGQTQYGFIGTGTDM
    USA300_FPR3757  MCTGFTIQTLNNQVLLGRTMDYDYPLDGSPAVTPRNYRWKSRTGTTGQTQYGFIGTGTDM
                    ***************************************.* ******************

    COL             EGFIYGDGVNEHGVAISTQYFRGYSSYGSTHKADAMNITQNEIVTWILVYTTSIEDMKQQ
    N315            EGFIYGDGVNEHGVAISTQYFRGYSSYGSTHKADAMNITQNEIVTWILGYTTSIEDMKQQ
    NCTC8325        EGFIYGDGVNEHGVAISTQYFRGYSSYGSTHKADAMNITQNEIVTWILGYTTSIEDMKQQ
    Newman          EGFIYGDGVNEHGVAISTQYFRGYSSYGSTHKADAMNITQNEIVTWILGYTTSIEDMKQQ
    USA300_FPR3757  EGFIYGDGVNEHGVAISTQYFRGYSSYGSTHKADAMNITQNEIVTWILGYTTSIEDMKQQ
                    ************************************************ ***********

    COL             ASQIHVVAVYLNDIGEVPPLHYHVSDATGHTVEVSFKEGEVVIKDNPIGVLTNHPDLNWH
    N315            ASQIHVVAVYLNDIGEVPPLHYHVSDATGHSVEVSFKEGEVVIKDNPIGVLTNHPDLDWH
    NCTC8325        ASQIHVVAVYLNDIGEVPPLHYHVSDATGHTVEVSFKEGEVVIKDNPIGVLTNHPDLNWH
    Newman          ASQIHVVAVYLNDIGEVPPLHYHVSDATGHTVEVSFKEGEVVIKDNPIGVLTNHPDLNWH
    USA300_FPR3757  ASQIHVVAVYLNDIGEVPPLHYHVSDATGHTVEVSFKEGEVVIKDNPIGVLTNHPDLNWH
                    ******************************:**************************:**

    COL             YSNLRQYINISPYPATANLLEGVTIEPLGNEAGTFGLPGGFTSTERFVRMTFMKANIAQN
    N315            YSNLRQYINISPYPATAKLLEGVTIEPLGNEAGTFGLPGGFTSTERFVRMAFMKANIAQN
    NCTC8325        YSNLRQYINISPYPATANLLEGVTIEPLGNEAGTFGLPGGFTSTERFVRMAFMKANIAQN
    Newman          YSNLRQYINISPYPATANLLEGVTIEPLGNEAGTFGLPGGFTSTERFVRMAFMKANIAQN
    USA300_FPR3757  YSNLRQYINISPYPATANLLEGVTIEPLGNEAGTFGLPGGFTSTERFVRMAFMKANIAQN
                    *****************:********************************:*********

    COL             NDKEMDLMNAFYLLDAVNIPIGIVRPHDADNHYTMYQTVINLTTRTLYIKYYGSNELVAL
    N315            NDKEMDLMNAFYLLDAVNIPIGIVRPHDADNHYTMYQTVINLTTRTLYIKYYGSNEIVAL
    NCTC8325        NDKEMDLMNAFYLLDAVNIPIGIVRPHDADNHYTMYQTVINLTTRTLYIKYYGSNELVAL
    Newman          NDKEMDLMNAFYLLDAVNIPIGIVRPHDADNHYTMYQTVINLTTRTLYIKYYGSNELVAL
    USA300_FPR3757  NDKEMDLMNAFYLLDAVNIPIGIVRPHDADNHYTMYQTVINLTTRTLYIKYYGSNELVAL
                    ********************************************************:***

    COL             KLTDDLINRKDMTIFKPEKHITIRKLNDNQ
    N315            KLTDDLINRKDMTIFKPEKHITIRKLNDNQ
    NCTC8325        KLTDDLINRKDMTIFKPEKHITIRKLNDNQ
    Newman          KLTDDLINRKDMTIFKPEKHITIRKLNDNQ
    USA300_FPR3757  KLTDDLINRKDMTIFKPEKHITIRKLNDNQ
                    ******************************