From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001179000
  • symbol?: essB
  • description?: Putative secretion system component EssB/YukC

      descriptions from strain specific annotations:

    • Putative secretion system component EssB/YukC
    • protein essB
    • type VII secretion protein EssB
    • putative secretion system component EssB
    • virulence protein EssB
    • membrane associated protein
  • strand?: +
  • coordinates?: 1447360..1448694
  • synteny block?: BlockID0006980
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0286 (essB)
    08BA02176:
    C248_0276 (essB)
    11819-97:
    MS7_0277 (essB)
    71193:
    ST398NM01_0301
    ECT-R 2:
    ECTR2_247
    ED133:
    SAOV_0229
    ED98:
    SAAV_0254
    HO 5096 0412:
    SAEMRSA15_02450
    JH1:
    SaurJH1_0277
    JH9:
    SaurJH9_0270
    JKD6008:
    SAA6008_00260 (essB)
    JKD6159:
    SAA6159_00267 (essB)
    LGA251:
    SARLGA251_02500 (essB)
    M013:
    M013TW_0267
    MRSA252:
    SAR0283
    MSHR1132:
    SAMSHR1132_02540
    MSSA476:
    SAS0262
    Mu3:
    SAHV_0284
    Mu50:
    SAV0286
    MW2:
    MW0262
    RF122:
    SAB0227
    ST398:
    SAPIG0301
    T0131:
    SAT0131_00282
    TCH60:
    HMPREF0772_10214 (essB)
    TW20:
    SATW20_02880 (essB)
    USA300_TCH1516:
    USA300HOU_0301 (essB)
    VC40:
    SAVC_01180

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVKNHNPKNEMQDMLTPLDAEEAAKTKLRLDMREIPKSSIKPEHFHLMYLLEQHSPYFID
    N315            MVKNHNPKNEMQDMLTPLDAEEAAKTKLRLDMREIPKSSIKPEHFHLMYLLEQHSPYFID
    NCTC8325        MVKNHNPKNEMQDMLTPLDAEEAAKTKLRLDMREIPKSSIKPEHFHLMYLLEQHSPYFID
    Newman          MVKNHNPKNEMQDMLTPLDAEEAAKTKLRLDMREIPKSSIKPEHFHLMYLLEQHSPYFID
    USA300_FPR3757  MVKNHNPKNEMQDMLTPLDAEEAAKTKLRLDMREIPKSSIKPEHFHLMYLLEQHSPYFID
                    ************************************************************

    COL             AELTELRDSFQIHYDINDNHTPFDNIKSFTKNEKLRYLLNIKNLEEVNRTRYTFVLAPDE
    N315            AELTELRDSFQIHYDINDNHTPFDNIKSFTKNEKLRYLLNIKNLEEVNRTRYTFVLAPDE
    NCTC8325        AELTELRDSFQIHYDINDNHTPFDNIKSFTKNEKLRYLLNIKNLEEVNRTRYTFVLAPDE
    Newman          AELTELRDSFQIHYDINDNHTPFDNIKSFTKNEKLRYLLNIKNLEEVNRTRYTFVLAPDE
    USA300_FPR3757  AELTELRDSFQIHYDINDNHTPFDNIKSFTKNEKLRYLLNIKNLEEVNRTRYTFVLAPDE
                    ************************************************************

    COL             LFFTRDGLPIAKTRGLQNVVDPLPVSEAEFLTRYKALVICAFNEKQSFDALVEGNLELHK
    N315            LFFTRDGLPIAKTRGLQNVVDPLPVSEAEFLTRYKALVICAFNEKQSFDALVEGNLELHK
    NCTC8325        LFFTRDGLPIAKTRGLQNVVDPLPVSEAEFLTRYKALVICAFNEKQSFDALVEGNLELHK
    Newman          LFFTRDGLPIAKTRGLQNVVDPLPVSEAEFLTRYKALVICAFNEKQSFDALVEGNLELHK
    USA300_FPR3757  LFFTRDGLPIAKTRGLQNVVDPLPVSEAEFLTRYKALVICAFNEKQSFDALVEGNLELHK
                    ************************************************************

    COL             GTPFETKVIEAATLDLLTAFLDEQYQKQEQDYSQNYAYVRKVGHTVFKWVAIGMTTLSVL
    N315            GTPFETKVIEAATLDLLTAFLDEQYQKQEQDYSQNYAYVRKVGHTVFKWVAIGMTTLSVL
    NCTC8325        GTPFETKVIEAATLDLLTAFLDEQYQKQEQDYSQNYAYVRKVGHTVFKWVAIGMTTLSVL
    Newman          GTPFETKVIEAATLDLLTAFLDEQYQKQEQDYSQNYAYVRKVGHTVFKWVAIGMTTLSVL
    USA300_FPR3757  GTPFETKVIEAATLDLLTAFLDEQYQKQEQDYSQNYAYVRKVGHTVFKWVAIGMTTLSVL
                    ************************************************************

    COL             LIAFLAFLYFSVMKHNERIEKGYQAFVKDDYTQVLNTYDDLDGKKLDKEALYIYAKSYIQ
    N315            LIAFLAFLYFSVMKHNERIEKGYQAFVKDDYTQVLNTYDDLDGKKLDKEALYIYAKSYIQ
    NCTC8325        LIAFLAFLYFSVMKHNERIEKGYQAFVKDDYTQVLNTYDDLDGKKLDKEALYIYAKSYIQ
    Newman          LIAFLAFLYFSVMKHNERIEKGYQAFVKDDYTQVLNTYDDLDGKKLDKEALYIYAKSYIQ
    USA300_FPR3757  LIAFLAFLYFSVMKHNERIEKGYQAFVKDDYTQVLNTYDDLDGKKLDKEALYIYAKSYIQ
                    ************************************************************

    COL             TNKQGLEKDKKENLLNNVTPNSNKDYLLYWMELGQGHLDEAINIATYLDDNDITKLALIN
    N315            TNKQGLEKDKKENLLNNVTPNSNKDYLLYWMELGQGHLDEAINIATYLDDNDITKLALIN
    NCTC8325        TNKQGLEKDKKENLLNNVTPNSNKDYLLYWMELGQGHLDEAINIATYLDDNDITKLALIN
    Newman          TNKQGLEKDKKENLLNNVTPNSNKDYLLYWMELGQGHLDEAINIATYLDDNDITKLALIN
    USA300_FPR3757  TNKQGLEKDKKENLLNNVTPNSNKDYLLYWMELGQGHLDEAINIATYLDDNDITKLALIN
                    ************************************************************

    COL             KLNEIKNNGDLSNDKRSEETKKYNDKLQDILDKEKQVKDEKAKSEEEKAKAKDEKLKQQE
    N315            KLNEIKNNGDLSNDKRSEETKKYNDKLQDILDKEKQVKDEKAKSEEEKAKAKDEKLKQQE
    NCTC8325        KLNEIKNNGDLSNDKRSEETKKYNDKLQDILDKEKQVKDEKAKSEEEKAKAKDEKLKQQE
    Newman          KLNEIKNNGDLSNDKRSEETKKYNDKLQDILDKEKQVKDEKAKSEEEKAKAKDEKLKQQE
    USA300_FPR3757  KLNEIKNNGDLSNDKRSEETKKYNDKLQDILDKEKQVKDEKAKSEEEKAKAKDEKLKQQE
                    ************************************************************

    COL             ENEKKQKEQAQKDKEKRQEAERKK
    N315            ENEKKQKEQAQKDKEKRQEAERKK
    NCTC8325        ENEKKQKEQAQKDKEKRQEAERKK
    Newman          ENEKKQKEQAQKDKEKRQEAERKK
    USA300_FPR3757  ENEKKQKEQAQKDKEKRQEAERKK
                    ************************