From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001185000
  • symbol?: esxC
  • description?: protein EsaC

      descriptions from strain specific annotations:

    • protein EsaC
    • EsaC protein within ESAT-6 gene cluster
    • virulence protein EsaC
  • strand?: +
  • coordinates?: 1456464..1456856
  • synteny block?: BlockID0007040
  • occurrence?: in 66% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0288 (esaC)
    08BA02176:
    11819-97:
    MS7_0279 (esaC)
    71193:
    ECT-R 2:
    ECTR2_249
    ED133:
    SAOV_0231
    ED98:
    SAAV_0256
    HO 5096 0412:
    JH1:
    SaurJH1_0279
    JH9:
    SaurJH9_0272
    JKD6008:
    JKD6159:
    SAA6159_00269 (esaC)
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    SAMSHR1132_02560
    MSSA476:
    SAS0264
    Mu3:
    SAHV_0286
    Mu50:
    SAV0289
    MW2:
    MW0264
    RF122:
    SAB0229
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_0303 (esaC)
    VC40:
    SAVC_01195

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNFNDIETMVKSKFKDIKKHAEEIAHEIEVRSGYLRKAEQYKRLEFNLSFALDDIESTAK
    N315            MNFNDIETMVKSKFKDIKKHAEEIAHEIEVRSGYLRKAEQYKRLEFNLSIALDDVESTAK
    NCTC8325        MNFNDIETMVKSKFKDIKKHAEEIAHEIEVRSGYLRKAEQYKRLEFNLSFALDDIESTAK
    Newman          MNFNDIETMVKSKFKDIKKHAEEIAHEIEVRSGYLRKAEQYKRLEFNLSFALDDIESTAK
    USA300_FPR3757  MNFNDIETMVKSKFKDIKKHAEEIAHEIEVRSGYLRKAEQYKRLEFNLSFALDDIESTAK
                    *************************************************:****:*****

    COL             DVQTAKSSANKDSVTVKGKAPNTLYIEKRNLMKQKLEMLGEDIDKNKESLQKAKEIAGEK
    N315            DVQTAKSSANKDSVSVKGKAPNTLYIEKRNLMKQKLEMLGEDIDKNKESLQKAKGIAGEK
    NCTC8325        DVQTAKSSANKDSVTVKGKAPNTLYIEKRNLMKQKLEMLGEDIDKNKESLQKAKEIAGEK
    Newman          DVQTAKSSANKDSVTVKGKAPNTLYIEKRNLMKQKLEMLGEDIDKNKESLQKAKEIAGEK
    USA300_FPR3757  DVQTAKSSANKDSVTVKGKAPNTLYIEKRNLMKQKLEMLGEDIDKNKESLQKAKEIAGEK
                    **************:*************************************** *****

    COL             ASEYFNKAMN
    N315            ASEYFNKAMN
    NCTC8325        ASEYFNKAMN
    Newman          ASEYFNKAMN
    USA300_FPR3757  ASEYFNKAMN
                    **********