From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001197000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 1467656..1467874
  • synteny block?: BlockID0007110
  • occurrence?: in 75% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0296
    08BA02176:
    C248_0288
    11819-97:
    MS7_0287
    71193:
    ST398NM01_0313
    ECT-R 2:
    ECTR2_257
    ED133:
    ED98:
    SAAV_0264
    HO 5096 0412:
    JH1:
    SaurJH1_0287
    JH9:
    SaurJH9_0280
    JKD6008:
    SAA6008_00269
    JKD6159:
    LGA251:
    SARLGA251_02590
    M013:
    MRSA252:
    SAR0292
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_0294
    Mu50:
    SAV0297
    MW2:
    RF122:
    ST398:
    SAPIG0313
    T0131:
    SAT0131_00293
    TCH60:
    HMPREF0772_10205
    TW20:
    SATW20_02970
    USA300_TCH1516:
    USA300HOU_0311
    VC40:
    SAVC_01235

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MENQKQGNGLKIATWVFIVLTVVTPLFGIGSIVCSINYKKYDAEKGSKLLQIAIIVTIIA
    N315            MENQKQGNGLKIATWVFIVLTVVTPLFGIGSIVCSINYKKYDAEKGSKLLQIAIIVTIIA
    NCTC8325        MENQKQGNGLKIATWVFIVLTVVTPLFGIGSIVCSINYKKYDAEKGSKLLQIAIIVTIIA
    Newman          MENQKQGNGLKIATWVFIVLTVVTPLFGIGSIVCSINYKKYDAEKGSKLLQIAIIVTIIA
    USA300_FPR3757  MENQKQGNGLKIATWVFIVLTVVTPLFGIGSIVCSINYKKYDAEKGSKLLQIAIIVTIIA
                    ************************************************************

    COL             FVLNLLAYLGLR
    N315            FVLNLLAYLGLR
    NCTC8325        FVLNLLAYLGLR
    Newman          FVLNLLAYLGLR
    USA300_FPR3757  FVLNLLAYLGLR
                    ************