From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN001199000
  • symbol?: esaG
  • description?: Repetitive hypothetical protein
  • strand?: +
  • coordinates?: 1470014..1480461
  • synteny block?: BlockID0007130
  • occurrence?: in 56% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0293
    08BA02176:
    11819-97:
    MS7_0284
    71193:
    ECT-R 2:
    ECTR2_254
    ED133:
    ED98:
    SAAV_0261
    HO 5096 0412:
    JH1:
    SaurJH1_0284
    JH9:
    SaurJH9_0277
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS0278
    Mu3:
    SAHV_0291
    Mu50:
    SAV0294
    MW2:
    MW0278
    RF122:
    ST398:
    T0131:
    TCH60:
    HMPREF0772_10202
    TW20:
    USA300_TCH1516:
    USA300HOU_0308
    VC40:
    SAVC_01220

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTFEEKLSKIYNEIANEISSMIPVEWEKVYTMAYIDDGGGEVFFNYTKPGSDDLNYYTNI
    N315            MTFEEKLSKIYNEIANEISNMIPVEWEKVYTMAYIDDGGGEVFFNYTKPGSDDLNYYTDI
    NCTC8325        MTFEEKLSKIYNEIANEISSMIPVEWEKVYTMAYIDDGGGEVFFNYTKPGSDDLNYYTNI
    Newman          MTFEEKLSKIYNEIANEISSMIPVEWEKVYTMAYIDDGGGEVFFNYTKPGSDDLNYYTNI
    USA300_FPR3757  MTFEEKLSKIYNEIANEISSMIPVEWEKVYTMAYIDDGGGEVFFNYTKPGSDDLNYYTNI
                    *******************.**************************************:*

    COL             PKEYNISVQVFDDLWMDLYDLFEELRDLFKEEDLEPWTSCEFDFTREGELKVSFDYIDWI
    N315            PKEYNISVQVFDDLWMDLYDLFEELRDLFKEEDLEPWTSCEFDFTREGKLKVSFDYIDWI
    NCTC8325        PKEYNISVQVFDDLWMDLYDLFEELRDLFKEEDLEPWTSCEFDFTREGELKVSFDYIDWI
    Newman          PKEYNISVQVFDDLWMDLYDLFEELRDLFKEEDLEPWTSCEFDFTREGELKVSFDYIDWI
    USA300_FPR3757  PKEYNISVQVFDDLWMDLYDLFEELRDLFKEEDLEPWTSCEFDFTREGELKVSFDYIDWI
                    ************************************************:***********

    COL             NSEFGQIGRQNYYKYRKFGILPETEYEINKVKEIEQYIKELEE
    N315            NTEFDQLGRENYYMYKKFGVIPEMEYEMEEVKQIEQYIKEQEE
    NCTC8325        NSEFGQIGRQNYYKYRKFGILPETEYEINKVKEIEQYIKELEE
    Newman          NSEFGQIGRQNYYKYRKFGILPETEYEINKVKEIEQYIKELEE
    USA300_FPR3757  NSEFGQIGRQNYYKYRKFGILPETEYEINKVKEIEQYIKELEE
                    *:**.*:**:*** *:***::** ***:::**:******* **