From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001200000
  • symbol?:
  • description?: Repetitive hypothetical protein
  • strand?: +
  • coordinates?: 1470014..1480470
  • synteny block?: BlockID0007140
  • occurrence?: in 69% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0297
    08BA02176:
    C248_0285
    11819-97:
    71193:
    ST398NM01_0310
    ECT-R 2:
    ECTR2_258
    ED133:
    ED98:
    SAAV_0265
    HO 5096 0412:
    JH1:
    SaurJH1_0288
    JH9:
    SaurJH9_0281
    JKD6008:
    SAA6008_00270
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR0293
    MSHR1132:
    MSSA476:
    SAS0269
    Mu3:
    SAHV_0295
    Mu50:
    SAV0298
    MW2:
    MW0269
    RF122:
    ST398:
    SAPIG0310
    T0131:
    SAT0131_00294 (tgt)
    TCH60:
    HMPREF0772_10204
    TW20:
    SATW20_02980
    USA300_TCH1516:
    USA300HOU_0312
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTFEEKLSEMYSEIANKISSMIPVEWEKVYAMAYIDDGGGEVFYYYTEPGSNELYYYTSV
    N315            MTFEEKLSQMYNEIANKISSMIPVEWEKVYTMAYIDDEGGEVFYYYTEPGSNELYYYTSV
    Newman          MTFEEKLSEMYSEIANKISSMIPVEWEKVYAMAYIDDGGGEVFYYYTEPGSNELYYYTSV
    USA300_FPR3757  MTFEEKLSEMYSEIANKISSMIPVEWEKVYAMAYIDDGGGEVFYYYTEPGSNELYYYTSV
                    ********:**.******************:****** **********************

    COL             LNKYDISESEFMDSVYELYKQFQNLRNLFKEEGHEPWTSCEFDFTREGELKVSFDYIDWI
    N315            LNKYDISESEFMDSAYELYKQFQNLRNIFKEEGYEPWTSCEFDFTKEGELKVSFDYIDWI
    Newman          LNKYDISESEFMDSVYELYKQFQNLRNLFKEEGHEPWTSCEFDFTREGELKVSFDYIDWI
    USA300_FPR3757  LNKYDISESEFMDSVYELYKQFQNLRNLFKEEGHEPWTSCEFDFTREGELKVSFDYIDWI
                    **************.************:*****:***********:**************

    COL             NSEFGQVGRQNYYKYRKFGILPETEYEINKVKEIEQYVKEQEEAEQ
    N315            NTEFDQLGRQNYYMYKKFGVIPEMEYEMEEVKEIEQYIKEQEEAEQ
    Newman          NSEFGQVGRQNYYKYRKFGILPETEYEINKVKEIEQYVKEQEEAEQ
    USA300_FPR3757  NSEFGQVGRQNYYKYRKFGILPETEYEINKVKEIEQYVKEQEEAEQ
                    *:**.*:****** *:***::** ***:::*******:********