From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001201000
  • symbol?:
  • description?: Repetitive hypothetical protein

      descriptions from strain specific annotations:

    • Repetitive hypothetical protein
    • pseudogene
  • strand?: +
  • coordinates?: 1472082..1472748
  • synteny block?: BlockID0007150
  • occurrence?: in 72% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0301
    08BA02176:
    11819-97:
    MS7_0292
    71193:
    ECT-R 2:
    ECTR2_262
    ED133:
    SAOV_0236
    ED98:
    SAAV_0269
    HO 5096 0412:
    JH1:
    SaurJH1_0292
    JH9:
    SaurJH9_0285
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    M013TW_0283
    MRSA252:
    SAR0297
    MSHR1132:
    SAMSHR1132_02760
    MSSA476:
    SAS0279
    Mu3:
    SAHV_0299
    Mu50:
    SAV0302
    MW2:
    MW0279
    RF122:
    SAB0239
    ST398:
    T0131:
    TCH60:
    TW20:
    SATW20_03070
    USA300_TCH1516:
    USA300HOU_0320
    VC40:
    SAVC_01260

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTFEEKLSQMYNEIANEISGMIPVEWEKVYTIAYVDDEGGEVVFNYTKPGSEDLNYYSDI
    N315            MIFEEKLSQMYNEIANEISGMIPVEWEKVYTIAYVDDEGGEVVFNYTKPGSDELNYYTYI
    NCTC8325        MTFEEKLSQMYNEIANEISGMIPVEWEKVYTIAYVDDEGGEVVFNYTKPGSEDLNYYSDI
    Newman          MTFEEKLSQMYNEIANEISGMIPVEWEKVYTIAYVDDEGGEVVFNYTKPGSEDLNYYSDI
    USA300_FPR3757  MTFEEKLSQMYNEIANEISGMIPVEWEKVYTIAYVDDEGGEVVFNYTKPGSEDLNYYSDI
                    * *************************************************::****: *

    COL             PKDCNVSKDIFKNSWFKVYRMFDELRETFKKEDLEPWTSCEFDFTRKGNLKVSFDYIDWI
    N315            PREYNVSEKVFYDLWTDLYRLFKKLRNAF-KEDLEPWTSCEFDFTREGNLKVSFDYIDWI
    NCTC8325        PKDCNVSKDIFKNSWFKVYRMFDELRETFKKEDLEPWTSCEFDFTRKGNLKVSFDYIDWI
    Newman          PKDCNVSKDIFKNSWFKVYRMFDELRETFKKEDLEPWTSCEFDFTRKGNLKVSFDYIDWI
    USA300_FPR3757  PKDCNVSKDIFKNSWFKVYRMFDELRETFKKEDLEPWTSCEFDFTRKGNLKVSFDYIDWI
                    *:: ***:.:* : * .:**:*.:**::* ****************:*************

    COL             KLGFGPSGKENYYMYKKFGILPDMEYEMEEIRAVEKYVKEQE
    N315            KLGFGPSGKENYYMYKKFGVLPETEYEMEEIREVEKYVKDQE
    NCTC8325        KLGFGPSGKENYYMYKKFGILPDMEYEMEEIRAVEKYVKEQE
    Newman          KLGFGPSGKENYYMYKKFGILPDMEYEMEEIRAVEKYVKEQE
    USA300_FPR3757  KLGFGPSGKENYYMYKKFGILPDMEYEMEEIRAVEKYVKEQE
                    *******************:**: ******** ******:**