From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN001208000
  • symbol?:
  • description?: Repetitive hypothetical protein
  • strand?: +
  • coordinates?: 1480481..1498128
  • synteny block?: BlockID0007200
  • occurrence?: in 50% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0300
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ECTR2_261
    ED133:
    SAOV_0243
    ED98:
    SAAV_0268
    HO 5096 0412:
    SAEMRSA15_02580
    JH1:
    SaurJH1_0291
    JH9:
    SaurJH9_0284
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    M013TW_0282
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS0276
    Mu3:
    SAHV_0298
    Mu50:
    SAV0301
    MW2:
    MW0276
    RF122:
    ST398:
    T0131:
    TCH60:
    HMPREF0772_10195
    TW20:
    SATW20_03060
    USA300_TCH1516:
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTFEEKLSQMYNEIANEISGMIPVEWENIYTIAYVTDQGGEVIFNYTKPGSDELNYYTYI
    N315            MNFEEKLSQMYNEIANEISGMIPVEWEQVFTIAYVTDQAGEVIFNYTKPGSDELNYYTYI
                    *.*************************:::********.*********************

    COL             PREYNVSEKVFYDLWTDLYRLFKKLRETFKEEGLEPWTSSEFDFTSEGKLKVSFDYIDWI
    N315            PREYNVSEKVFYDLWTDLYRLFKKLRNAFKEEDLEPWTSCEFDFTSEGKLKVSFDYIDWI
                    **************************::****.******.********************

    COL             NTEFDQLGRENYYMYKKFGVLPEMEYEMEEVKEIEQYIKEQDEAEL
    N315            NTEFDQLGRENYYMYKKFGVIPEMEYEMEEVKEIEQYIKEQDEAEL
                    ********************:*************************