From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001228000
  • symbol?:
  • description?: 5'-nucleotidase, lipoprotein e(P4) family

      descriptions from strain specific annotations:

    • 5'-nucleotidase, lipoprotein e(P4) family
    • 5'-nucleotidase
    • 5'-nucleotidase, lipoprotein e(P4) family protein
    • acid phosphatase
    • acid phosphatase5'-nucleotidase, lipoprotein e(P4) family
    • lipoprotein e(P4) family 5'-nucleotidase
    • outer membrane protein
    • secreted acid phosphatase
  • strand?: +
  • coordinates?: 1514670..1515560
  • synteny block?: BlockID0007390
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0306
    08BA02176:
    C248_0295
    11819-97:
    MS7_0297
    71193:
    ST398NM01_0320
    ECT-R 2:
    ECTR2_267
    ED133:
    SAOV_0259
    ED98:
    SAAV_0274
    HO 5096 0412:
    SAEMRSA15_02630
    JH1:
    SaurJH1_0297
    JH9:
    SaurJH9_0290
    JKD6008:
    SAA6008_00283
    JKD6159:
    SAA6159_00283
    LGA251:
    SARLGA251_02690
    M013:
    M013TW_0288
    MRSA252:
    SAR0304
    MSHR1132:
    SAMSHR1132_02810
    MSSA476:
    SAS0284
    Mu3:
    SAHV_0304
    Mu50:
    SAV0307
    MW2:
    MW0284
    RF122:
    SAB0244
    ST398:
    SAPIG0320
    T0131:
    SAT0131_00310
    TCH60:
    HMPREF0772_10188
    TW20:
    SATW20_03120
    USA300_TCH1516:
    USA300HOU_0327
    VC40:
    SAVC_01285

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKISKYIAIASLSVAVTVSAPQTTNSTAFAKSSAEVQQTQQASIPASQKANLGNQNIMA
    N315            MNKISKYIAIASLSVAVTVSAPQTTNSTAFAKSSAEVQQTQQASIPASQKANLGNQNIMA
    NCTC8325        MNKISKYIAIASLSVAVTVSAPQTTNSTAFAKSSAEVQQTQQASIPASQKANLGNQNIMA
    Newman          MNKISKYIAIASLSVAVTVSAPQTTNSTAFAKSSAEVQQTQQASIPASQKANLGNQNIMA
    USA300_FPR3757  MNKISKYIAIASLSVAVTVSAPQTTNSTAFAKSSAEVQQTQQASIPASQKANLGNQNIMA
                    ************************************************************

    COL             VAWYQNSAEAKALYLQGYNSAKTQLDKEIKKNKGKHKLAIALDLDETVLDNSPYQGYASI
    N315            VAWYQNSAEAKALYLQGYNSAKTQLDKEIKKNKGKHKLAIALDLDETVLDNSPYQGYASI
    NCTC8325        VAWYQNSAEAKALYLQGYNSAKTQLDKEIKKNKGKHKLAIALDLDETVLDNSPYQGYASI
    Newman          VAWYQNSAEAKALYLQGYNSAKTQLDKEIKKNKGKHKLAIALDLDETVLDNSPYQGYASI
    USA300_FPR3757  VAWYQNSAEAKALYLQGYNSAKTQLDKEIKKNKGKHKLAIALDLDETVLDNSPYQGYASI
                    ************************************************************

    COL             HNKPFPEGWHEWVQAAKAKPVYGAKEFLKYADKKGVDIYYISDRDKEKDLKATQKNLKQQ
    N315            HNKPFPEGWHEWVQAAKAKPVYGAKEFLKYADKKGVDIYYISDRDKEKDLKATQKNLKQQ
    NCTC8325        HNKPFPEGWHEWVQAAKAKPVYGAKEFLKYADKKGVDIYYISDRDKEKDLKATQKNLKQQ
    Newman          HNKPFPEGWHEWVQAAKAKPVYGAKEFLKYADKKGVDIYYISDRDKEKDLKATQKNLKQQ
    USA300_FPR3757  HNKPFPEGWHEWVQAAKAKPVYGAKEFLKYADKKGVDIYYISDRDKEKDLKATQKNLKQQ
                    ************************************************************

    COL             GIPQAKKSHILLKGKDDKSKESRRQMVQKDHKLVMLFGDNLLDFTDPKEATAESREALIE
    N315            GIPQAKKSHILLKGKDDKSKESRRQMVQKDHKLVMLFGDNLLDFTDPKEATAESREALIE
    NCTC8325        GIPQAKKSHILLKGKDDKSKESRRQMVQKDHKLVMLFGDNLLDFTDPKEATAESREALIE
    Newman          GIPQAKKSHILLKGKDDKSKESRRQMVQKDHKLVMLFGDNLLDFTDPKEATAESREALIE
    USA300_FPR3757  GIPQAKKSHILLKGKDDKSKESRRQMVQKDHKLVMLFGDNLLDFTDPKEATAESREALIE
                    ************************************************************

    COL             KHKDDFGKKYIIFPNPMYGSWEATIYNNNYKASDKAKDKLRKNAIKQFDPKTGEVK
    N315            KHKDDFGKKYIIFPNPMYGSWEATIYNNNYKASDKAKDKLRKNAIKQFDPKTGEVK
    NCTC8325        KHKDDFGKKYIIFPNPMYGSWEATIYNNNYKASDKAKDKLRKNAIKQFDPKTGEVK
    Newman          KHKDDFGKKYIIFPNPMYGSWEATIYNNNYKASDKAKDKLRKNAIKQFDPKTGEVK
    USA300_FPR3757  KHKDDFGKKYIIFPNPMYGSWEATIYNNNYKASDKAKDKLRKNAIKQFDPKTGEVK
                    ********************************************************