From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001231000
  • symbol?:
  • description?: ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • ABC transporter ATP-binding protein
    • peptide ABC transporter ATP-binding protein
    • ABC superfamily ATP binding cassette transporter, binding protein
    • ABC transporter family protein
    • lipoprotein-releasing system ATP-binding protein LolD
  • strand?: +
  • coordinates?: 1516872..1517549
  • synteny block?: BlockID0007420
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0308
    08BA02176:
    C248_0298
    11819-97:
    MS7_0299
    71193:
    ST398NM01_0322
    ECT-R 2:
    ECTR2_269
    ED133:
    SAOV_0262
    ED98:
    SAAV_0276
    HO 5096 0412:
    SAEMRSA15_02650
    JH1:
    SaurJH1_0299
    JH9:
    SaurJH9_0292
    JKD6008:
    SAA6008_00285
    JKD6159:
    SAA6159_00285
    LGA251:
    SARLGA251_02710
    M013:
    M013TW_0290
    MRSA252:
    SAR0306
    MSHR1132:
    SAMSHR1132_02830
    MSSA476:
    SAS0286
    Mu3:
    SAHV_0306
    Mu50:
    SAV0309
    MW2:
    MW0286
    RF122:
    SAB0246
    ST398:
    SAPIG0322
    T0131:
    SAT0131_00313 (radC)
    TCH60:
    HMPREF0772_10186
    TW20:
    SATW20_03140
    USA300_TCH1516:
    USA300HOU_0329
    VC40:
    SAVC_01295

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLKFENVTKSFKDGNRNIEAVKDTNFEINKGDIIALVGPSGSGKSTFLTMAGALQTPTSG
    N315            MLKFENVTKSFKDGNRNIEAVKDTNFEINKGDIIALVGPSGSGKSTFLTMAGALQTPTSG
    NCTC8325        MLKFENVTKSFKDGNRNIEAVKDTNFEINKGDIIALVGPSGSGKSTFLTMAGALQTPTSG
    Newman          MLKFENVTKSFKDGNRNIEAVKDTNFEINKGDIIALVGPSGSGKSTFLTMAGALQTPTSG
    USA300_FPR3757  MLKFENVTKSFKDGNRNIEAVKDTNFEINKGDIIALVGPSGSGKSTFLTMAGALQTPTSG
                    ************************************************************

    COL             HILINNQDITTMKQKALAKVRMSEIGFILQATNLVPFLTVKQQFTLLKKKNKNVMSNEDY
    N315            HILINNQDITTMKQKALAKVRMSEIGFILQATNLVPFLTVKQQFTLLKKKNKNVMSNEDY
    NCTC8325        HILINNQDITTMKQKALAKVRMSEIGFILQATNLVPFLTVKQQFTLLKKKNKNVMSNEDY
    Newman          HILINNQDITTMKQKALAKVRMSEIGFILQATNLVPFLTVKQQFTLLKKKNKNVMSNEDY
    USA300_FPR3757  HILINNQDITTMKQKALAKVRMSEIGFILQATNLVPFLTVKQQFTLLKKKNKNVMSNEDY
                    ************************************************************

    COL             QQLMSQLGLTSLLNKLPSEISGGQKQRVAIAKALYTNPSIILADEPTAALDTENAIEVIK
    N315            QQLMSQLGLTSLLNKLPSEISGGQKQRVAIAKALYTNPSIILADEPTAALDTENAIEVIK
    NCTC8325        QQLMSQLGLTSLLNKLPSEISGGQKQRVAIAKALYTNPSIILADEPTAALDTENAIEVIK
    Newman          QQLMSQLGLTSLLNKLPSEISGGQKQRVAIAKALYTNPSIILADEPTAALDTENAIEVIK
    USA300_FPR3757  QQLMSQLGLTSLLNKLPSEISGGQKQRVAIAKALYTNPSIILADEPTAALDTENAIEVIK
                    ************************************************************

    COL             ILRDQAKQRKKACIIVTHDERLKAYCDRSYHMKDGVLNLENETVE
    N315            ILRDQAKKRKKACIIVTHDERLKAYCDRSYHMKDGVLNLENETVE
    NCTC8325        ILRDQAKQRKKACIIVTHDERLKAYCDRSYHMKDGVLNLENETVE
    Newman          ILRDQAKQRKKACIIVTHDERLKAYCDRSYHMKDGVLNLENETVE
    USA300_FPR3757  ILRDQAKQRKKACIIVTHDERLKAYCDRSYHMKDGVLNLENETVE
                    *******:*************************************