From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001237000
  • symbol?:
  • description?: pyrimidine nucleoside transporter

      descriptions from strain specific annotations:

    • pyrimidine nucleoside transporter
    • Na+ dependent nucleoside transporter
    • nucleoside permease NupC, putative
    • pyrimidine nucleoside transport protein
    • nucleoside permease nupC (Nucleoside-transport system protein nupC)
    • putative nucleoside permease
    • putative nucleoside permease NupC
    • CNT family concentrative nucleoside transporter
    • Nucleoside permease
    • nucleoside transporter permease
    • putative pyrimidine nucleoside transport protein
    • Na+ dependent nucleoside transporter family protein
  • strand?: +
  • coordinates?: 1521165..1522385
  • synteny block?: BlockID0007480
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0312
    08BA02176:
    C248_0302
    11819-97:
    MS7_0303
    71193:
    ST398NM01_0326
    ECT-R 2:
    ECTR2_273
    ED133:
    SAOV_0266
    ED98:
    SAAV_0280
    HO 5096 0412:
    SAEMRSA15_02690
    JH1:
    SaurJH1_0303
    JH9:
    SaurJH9_0296
    JKD6008:
    SAA6008_00289
    JKD6159:
    SAA6159_00289
    LGA251:
    SARLGA251_02750
    M013:
    M013TW_0294
    MRSA252:
    SAR0310
    MSHR1132:
    SAMSHR1132_02870
    MSSA476:
    SAS0290
    Mu3:
    SAHV_0310
    Mu50:
    SAV0313
    MW2:
    MW0290
    RF122:
    SAB0250
    ST398:
    SAPIG0326
    T0131:
    SAT0131_00317
    TCH60:
    HMPREF0772_10182 (nupC)
    TW20:
    SATW20_03180
    USA300_TCH1516:
    USA300HOU_0333
    VC40:
    SAVC_01315

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNILFAITGIAFALFVAFLFSFDRKKIDFKKTLIMIFIQVLIVLFMMNTTIGLTILTALG
    N315            MNILFAITGIAFALFVAFLFSFDRKNIDFKKTLIMIFIQVLIVLFMMNTTIGLTILTALG
    NCTC8325        MNILFAITGIAFALFVAFLFSFDRKKIDFKKTLIMIFIQVLIVLFMMNTTIGLTILTALG
    Newman          MNILFAITGIAFALFVAFLFSFDRKKIDFKKTLIMIFIQVLIVLFMMNTTIGLTILTALG
    USA300_FPR3757  MNILFAITGIAFALFVAFLFSFDRKKIDFKKTLIMIFIQVLIVLFMMNTTIGLTILTALG
                    *************************:**********************************

    COL             SFFEGLINISKAGINFVFGDIQNKNGFTFFLNVLLPLVFISVLIGIFNYIKVLPFIIKYV
    N315            SFFEGLINVSKAGINFVFGDIQNKNGFTFFLNVLLPLVFISVLIGIFNYIKVLPFIIKYV
    NCTC8325        SFFEGLINISKAGINFVFGDIQNKNGFTFFLNVLLPLVFISVLIGIFNYIKVLPFIIKYV
    Newman          SFFEGLINISKAGINFVFGDIQNKNGFTFFLNVLLPLVFISVLIGIFNYIKVLPFIIKYV
    USA300_FPR3757  SFFEGLINISKAGINFVFGDIQNKNGFTFFLNVLLPLVFISVLIGIFNYIKVLPFIIKYV
                    ********:***************************************************

    COL             GIAINKITRMGRLESYFAISTAMFGQPEVYLTIKDIIPRLSRAKLYTIATSGMSAVSMAM
    N315            GIAINKITRMGRLESYFAISTAMFGQPEVYLTIKDIIPRLSRAKLYTIATSGMSAVSMAM
    NCTC8325        GIAINKITRMGRLESYFAISTAMFGQPEVYLTIKDIIPRLSRAKLYTIATSGMSAVSMAM
    Newman          GIAINKITRMGRLESYFAISTAMFGQPEVYLTIKDIIPRLSRAKLYTIATSGMSAVSMAM
    USA300_FPR3757  GIAINKITRMGRLESYFAISTAMFGQPEVYLTIKDIIPRLSRAKLYTIATSGMSAVSMAM
                    ************************************************************

    COL             LGSYMQMIEPKFVVTAVMLNIFSALIIASVINPYKSDDTDVEIDNLTKSTETKTLNGKTG
    N315            LGSYMQMIEPKFVVTAVMLNIFSALIIASVINPYKSDDSDVEIDNLTKSTETKSVNGKTG
    NCTC8325        LGSYMQMIEPKFVVTAVMLNIFSALIIASVINPYKSDDTDVEIDNLTKSTETKTLNGKTG
    Newman          LGSYMQMIEPKFVVTAVMLNIFSALIIASVINPYKSDDTDVEIDNLTKSTETKTLNGKTG
    USA300_FPR3757  LGSYMQMIEPKFVVTAVMLNIFSALIIASVINPYKSDDTDVEIDNLTKSTETKTLNGKTG
                    **************************************:**************::*****

    COL             KPKKVAFFQMIGDSAMDGFKIAVVVAVMLLAFISLMEAINIMFGSVGLNFKQLIGYVFAP
    N315            KPKKVAFFQMIGDSAMDGFKIAVVVAVMLLAFISLMEAINIMFGSVGLNFKQLIGYVFAP
    NCTC8325        KPKKVAFFQMIGDSAMDGFKIAVVVAVMLLAFISLMEAINIMFGSVGLNFKQLIGYVFAP
    Newman          KPKKVAFFQMIGDSAMDGFKIAVVVAVMLLAFISLMEAINIMFGSVGLNFKQLIGYVFAP
    USA300_FPR3757  KPKKVAFFQMIGDSAMDGFKIAVVVAVMLLAFISLMEAINIMFGSVGLNFKQLIGYVFAP
                    ************************************************************

    COL             IAFLMGIPWSEAVPAGSLMATKLITNEFVAMLDFKNVLGDVSARTQGIISVYLVSFANFG
    N315            IAFLMGIPWSEAVPAGSLMATKLITNEFVAMLDFKNVLGDVSARTQGIISVYLVSFANFG
    NCTC8325        IAFLMGIPWSEAVPAGSLMATKLITNEFVAMLDFKNVLGDVSARTQGIISVYLVSFANFG
    Newman          IAFLMGIPWSEAVPAGSLMATKLITNEFVAMLDFKNVLGDVSARTQGIISVYLVSFANFG
    USA300_FPR3757  IAFLMGIPWSEAVPAGSLMATKLITNEFVAMLDFKNVLGDVSARTQGIISVYLVSFANFG
                    ************************************************************

    COL             TVGIIVGSIKGISDKQGEKVASFAMRLLLGSTLASIISGSIIGLVL
    N315            TVGIIVGSIKGISDKQGEKVSSFAMRLLLGSTLASIISGSIIGLVL
    NCTC8325        TVGIIVGSIKGISDKQGEKVASFAMRLLLGSTLASIISGSIIGLVL
    Newman          TVGIIVGSIKGISDKQGEKVASFAMRLLLGSTLASIISGSIIGLVL
    USA300_FPR3757  TVGIIVGSIKGISDKQGEKVASFAMRLLLGSTLASIISGSIIGLVL
                    ********************:*************************