From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001243000
  • symbol?:
  • description?: histidine transporter

      descriptions from strain specific annotations:

    • histidine transporter
    • membrane spanning protein
    • nucleoside recognition domain-containing protein
    • Nucleoside recognition domain protein
    • nucleoside recognition family protein
    • putative histidine uptake transporter
  • strand?: -
  • coordinates?: 1528295..1529608
  • synteny block?: BlockID0007540
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0318
    08BA02176:
    C248_0308
    11819-97:
    MS7_0309
    71193:
    ST398NM01_0332
    ECT-R 2:
    ECTR2_279
    ED133:
    SAOV_0272
    ED98:
    SAAV_0286
    HO 5096 0412:
    SAEMRSA15_02750
    JH1:
    SaurJH1_0309
    JH9:
    SaurJH9_0302
    JKD6008:
    SAA6008_00295
    JKD6159:
    SAA6159_00295
    LGA251:
    SARLGA251_02810
    M013:
    M013TW_0300
    MRSA252:
    SAR0316
    MSHR1132:
    SAMSHR1132_02930
    MSSA476:
    SAS0296
    Mu3:
    SAHV_0316
    Mu50:
    SAV0319
    MW2:
    MW0296
    RF122:
    SAB0256c
    ST398:
    SAPIG0332
    T0131:
    SAT0131_00324 (sirA)
    TCH60:
    HMPREF0772_10176
    TW20:
    SATW20_03240
    USA300_TCH1516:
    USA300HOU_0339
    VC40:
    SAVC_01345

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ----------------MNQYHSNAQQPSAWRFFVYSLVGILCFFIPFTINGNNTIFVDHV
    N315            ----------------MNQYHSNAQQPSAWRFFVYSLVGILCFFIPFTINGNNTIFVDHV
    NCTC8325        ----------------MNQYHSNAQQPSAWRFFVYSLVGILCFFIPFTINGNNTIFVDHV
    Newman          MHHTVLCIHLNKGVALMNQYHSNAQQPSAWRFFVYSLVGILCFFIPFTINGNNTIFVDHV
    USA300_FPR3757  ----------------MNQYHSNAQQPSAWRFFVYSLVGILCFFIPFTINGNNTIFVDHV
                                    ********************************************

    COL             HLAIRSIIGPLMPYVALIMILIGTALPIVRRTFMTSITNLVITLFKVAGAMIGIMYVFKI
    N315            HLAIRSIIGPLMPYVALIMILIGTALPIVRRTFMTSITNLVITLFKVAGAMIGIMYVFKI
    NCTC8325        HLAIRSIIGPLMPYVALIMILIGTALPIVRRTFMTSITNLVITLFKVAGAMIGIMYVFKI
    Newman          HLAIRSIIGPLMPYVALIMILIGTALPIVRRTFMTSITNLVITLFKVAGAMIGIMYVFKI
    USA300_FPR3757  HLAIRSIIGPLMPYVALIMILIGTALPIVRRTFMTSITNLVITLFKVAGAMIGIMYVFKI
                    ************************************************************

    COL             GPSILFKANYGPFLFEKLMMPLSILIPVGAIALSLLVGYGLLEFVGVYMEPIMRPIFKTP
    N315            GPSILFKANYGPFLFEKLMMPLSILIPVGAIALSLLVGYGLLEFVGVYMEPIMRPIFKTP
    NCTC8325        GPSILFKANYGPFLFEKLMMPLSILIPVGAIALSLLVGYGLLEFVGVYMEPIMRPIFKTP
    Newman          GPSILFKANYGPFLFEKLMMPLSILIPVGAIALSLLVGYGLLEFVGVYMEPIMRPIFKTP
    USA300_FPR3757  GPSILFKANYGPFLFEKLMMPLSILIPVGAIALSLLVGYGLLEFVGVYMEPIMRPIFKTP
                    ************************************************************

    COL             GKSAVDAVASFVGSYSLGLLITNRVYKQGMYNKREATIIATGFSTVSATFMIIVAKTLGL
    N315            GKSAVDAVASFVGSYSLGLLITNRVYKQGMYNKREATIIATGFSTVSATFMIIVAKTLGL
    NCTC8325        GKSAVDAVASFVGSYSLGLLITNRVYKQGMYNKREATIIATGFSTVSATFMIIVAKTLGL
    Newman          GKSAVDAVASFVGSYSLGLLITNRVYKQGMYNKREATIIATGFSTVSATFMIIVAKTLGL
    USA300_FPR3757  GKSAVDAVASFVGSYSLGLLITNRVYKQGMYNKREATIIATGFSTVSATFMIIVAKTLGL
                    ************************************************************

    COL             MPHWNLYFWITLVITFVVTAITAWLPPISNESTEYYNGQEGEQEVAIEGSRLKTAYAEAM
    N315            MPHWNLYFWITLVITFVVTAITAWLPPITNESTEYYNGQEGEQEVAIEGSRLKTAYAEAM
    NCTC8325        MPHWNLYFWITLVITFVVTAITAWLPPISNESTEYYNGQEGEQEVAIEGSRLKTAYAEAM
    Newman          MPHWNLYFWITLVITFVVTAITAWLPPISNESTEYYNGQEGEQEVAIEGSRLKTAYAEAM
    USA300_FPR3757  MPHWNLYFWITLVITFVVTAITAWLPPISNESTEYYNGQEGEQEVAIEGSRLKTAYAEAM
                    ****************************:*******************************

    COL             KQNALTPSLVKNVWDNLKDGLEMTVGILPSILSIGFLGLIVANYTPFIDWLGYIFYPFIY
    N315            KQNALTPSLVKNVWDNFKDGLEMTVGILPSILSIGFLGLIVANYTPFIDWLGYIFYPFIY
    NCTC8325        KQNALTPSLVKNVWDNLKDGLEMTVGILPSILSIGFLGLIVANYTPFIDWLGYIFYPFIY
    Newman          KQNALTPSLVKNVWDNLKDGLEMTVGILPSILSIGFLGLIVANYTPFIDWLGYIFYPFIY
    USA300_FPR3757  KQNALTPSLVKNVWDNLKDGLEMTVGILPSILSIGFLGLIVANYTPFIDWLGYIFYPFIY
                    ****************:*******************************************

    COL             IFPIADQALLAKASAISIVEMFLPSLLVTKAAMSTKFVVGVVSVSAIIFFSALVPCILAT
    N315            IFPIADQAVLAKASAISIVEMFLPSLLVTKAAMSTKFVVGVVSVSAIIFFSALVPCILAT
    NCTC8325        IFPIADQALLAKASAISIVEMFLPSLLVTKAAMSTKFVVGVVSVSAIIFFSALVPCILAT
    Newman          IFPIADQALLAKASAISIVEMFLPSLLVTKAAMSTKFVVGVVSVSAIIFFSALVPCILAT
    USA300_FPR3757  IFPIADQALLAKASAISIVEMFLPSLLVTKAAMSTKFVVGVVSVSAIIFFSALVPCILAT
                    ********:***************************************************

    COL             EIKIPVWKLIIIWFLRVALSLLITIPVALLIFG
    N315            EIKIPVWKLIIIWFLRVALSLLITIPVALLIFG
    NCTC8325        EIKIPVWKLIIIWFLRVALSLLITIPVALLIFG
    Newman          EIKIPVWKLIIIWFLRVALSLLITIPVALLIFG
    USA300_FPR3757  EIKIPVWKLIIIWFLRVALSLLITIPVALLIFG
                    *********************************