From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN001380000
  • symbol?:
  • description?: phage transcriptional activator

      descriptions from strain specific annotations:

    • phage transcriptional activator
    • phi77 ORF026-like protein phage transcriptional activator
    • phage protein
    • phage transcriptional regulator, RinA family protein
    • putative phage transcriptional activator
    • RinA family phage transcriptional regulator
  • strand?: +
  • coordinates?: 1673740..1674156
  • synteny block?: BlockID0008590
  • occurrence?: in 38% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    71193:
    ST398NM01_2934
    ECT-R 2:
    ED133:
    SAOV_1098
    ED98:
    SAAV_2035
    HO 5096 0412:
    JH1:
    JH9:
    JKD6008:
    SAA6008_02025
    JKD6159:
    SAA6159_01901
    LGA251:
    M013:
    M013TW_1461
    MRSA252:
    MSHR1132:
    SAMSHR1132_18100
    MSSA476:
    Mu3:
    Mu50:
    MW2:
    RF122:
    ST398:
    T0131:
    SAT0131_02104
    TCH60:
    TW20:
    SATW20_19630
    USA300_TCH1516:
    USA300HOU_1974
    VC40:

Genome Viewer[edit source | edit]

Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    Newman          MIKIEKHDIKKLEEYIQHIDNYRRELKMREYELLESHEPDNAGAGKSNLPGNPIERCAIK
    USA300_FPR3757  ---------------------------MREYELLESHEPDNAGAGKSNLPGNPIERCAIK
                                               *********************************

    Newman          KFSDNRYNTLRNIVNGVDRLIDESDEDTLELLRFRYWDCPIGCYEWEDIAHYFGTSKTSI
    USA300_FPR3757  KFSDNRYNTLRNIVNGVDRLIDESDEDTLELLRFRYWDCPIGCYEWEDIAHYFGTSKTSI
                    ************************************************************

    Newman          LRRRNALIDKLAKYIGYV
    USA300_FPR3757  LRRRNALIDKLAKYIGYV
                    ******************