From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN001394000
  • symbol?: dnaD2
  • description?: replication protein DnaD

      descriptions from strain specific annotations:

    • replication protein DnaD
    • phage regulatory protein
    • phiPVL ORF046-like protein
    • DNA replication protein DnaD
    • primosome subunit DnaD
    • pseudogene
    • putative phage regulatory protein
  • strand?: -
  • coordinates?: 1678631..1679197
  • synteny block?: BlockID0008730
  • occurrence?: in 25% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    JH1:
    SaurJH1_0332
    JH9:
    SaurJH9_0323
    JKD6008:
    SAA6008_02037
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    Mu3:
    Mu50:
    MW2:
    RF122:
    ST398:
    T0131:
    SAT0131_02118
    TCH60:
    TW20:
    SATW20_03430
    USA300_TCH1516:
    USA300HOU_1988 (dnaD2)
    VC40:

Genome Viewer[edit source | edit]

Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    Newman          MTGWIKLHRKLLDSPIFQNEKLFKVFA---YCLMKASHKDHTQLVGRRVVELEKGQFVFG
    USA300_FPR3757  MTGWISIDRSIQNHWLFKEKRTFSKFEAWIYLLMEANHSKAKVPIGNQIVTVERGQRLTS
                    *****.:.*.: :  :*:::: *. *    * **:*.*.. .  :*.::* :*:** : .

    Newman          RKRASEELRLKESTVRDYIKLLENLGTIVVKSDNKFSVITVVNWAIYQSMEENSDSKNDN
    USA300_FPR3757  ILTLSDLFNWSRFKVKTFLDLLESDGMLEVKTTSKYTLITIVNYDFYQSEQGRNQHQNDI
                        *: :. .. .*: ::.***. * : **: .*:::**:**: :*** : ..: :** 

    Newman          KSTTNQQQMDNKWTTNQQQINTNKNVKNGDNVKNGENEKKKVTAFDFFQDNGFGFITPYN
    USA300_FPR3757  KPTSKQHQSNINPTSKQHQTNTNNNDNKDNNEKNVNNEKKKTTAFDFFQDNGFGFITSYN
                    *.*::*:* : : *::*:* ***:* ::.:* ** :*****.***************.**

    Newman          LDDLNYYLDSFENDSDQIVTASLKIAKDRNKVTWGYAKSILNTWLNANLKSIEQVRAFEK
    USA300_FPR3757  LDDLNYYLDSFENDSDEIVTASLKIAKDRNKVTWGYAKSILNTWLNANLKSIEQVRAFEK
                    ****************:*******************************************

    Newman          QQLESKKQNYKPFVKQSKEKTPKWLTDSTRETKTPEVDENLEKDREAFIKRLNSKWE
    USA300_FPR3757  QQLESKKQNYKPFVKQSKEKTPKWLTDSTRETKTPEVDENLEKDREAFIKRLNSKWE
                    *********************************************************