From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN001403000
  • symbol?:
  • description?: phage protein

      descriptions from strain specific annotations:

    • phage protein
    • conserved hypothetical phage prtotein
    • phi PVL/orf 52-like protein
    • phiPVL ORF052-like protein
  • strand?: -
  • coordinates?: 1687603..1687857
  • synteny block?: BlockID0008820
  • occurrence?: in 25% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    MS7_1482
    71193:
    ECT-R 2:
    ED133:
    ED98:
    SAAV_0844
    HO 5096 0412:
    JH1:
    SaurJH1_1066
    JH9:
    SaurJH9_1047
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    M013TW_1472
    MRSA252:
    MSHR1132:
    MSSA476:
    Mu3:
    Mu50:
    MW2:
    RF122:
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_1982
    VC40:

Genome Viewer[edit source | edit]

NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    NCTC8325        MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGIEL
    USA300_FPR3757  MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEIRE----AINAQWVEYPE-
                    ****************************************** *    **: .  *  * 

    NCTC8325        DEAIGIMVSQVIYEYKEELENEKI
    USA300_FPR3757  DWASEVLREVRELEYEEEQENEN-
                    * *  :: .    **:** ***: