From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN001475000
  • symbol?:
  • description?: DUF1381 domain-containing protein

      descriptions from strain specific annotations:

    • DUF1381 domain-containing protein
    • phiSLT ORF 81b-like protein
    • phage protein
  • strand?: -
  • coordinates?: 1737773..1738375
  • synteny block?: BlockID0009500
  • occurrence?: in 31% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ED133:
    SAOV_1938c
    ED98:
    SAAV_0847
    HO 5096 0412:
    JH1:
    JH9:
    JKD6008:
    SAA6008_01863
    JKD6159:
    SAA6159_01390
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS0921
    Mu3:
    Mu50:
    MW2:
    RF122:
    ST398:
    T0131:
    TCH60:
    TW20:
    SATW20_03540
    USA300_TCH1516:
    USA300HOU_1465
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTQYLVTTFKDSTGLPHEHITVARDNQTFTVVEAENKEEAKEKYEAQVKRDAIIKASQLF
    NCTC8325        MTQYLVTTFKDSSGLPHEHFTAARDNQTFTVVEAESKEEAKEKYEAQVKRDAVIKLGQLF
    USA300_FPR3757  MTQYLVTTFKDSTGRKHTHITKAKSNQRFTVVEAESKEEAERKYEAQVKRDAVIKVGQLF
                    ************:*  * *:* *:.** *******.****:.**********:** .***

    COL             ENIRECGK
    NCTC8325        ENIRECGK
    USA300_FPR3757  ENIRECGK
                    ********