From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN001627000
  • symbol?:
  • description?: Holin

      descriptions from strain specific annotations:

    • Holin
    • phage-related holin
    • phage holin
    • holin protein
    • prophage L54a, holin
    • phiSLT ORF100b-like protein, holin
    • holin, SPP1 family
    • SPP1 family prophage L54a
  • strand?: -
  • coordinates?: 1920705..1921007
  • synteny block?: BlockID0010580
  • occurrence?: in 53% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    C248_0370
    11819-97:
    MS7_1447 (xhlB)
    71193:
    ST398NM01_0395
    ECT-R 2:
    ED133:
    SAOV_0341
    ED98:
    SAAV_2011
    HO 5096 0412:
    JH1:
    JH9:
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    M013TW_1439
    MRSA252:
    SAR1498
    MSHR1132:
    MSSA476:
    SAS0953
    Mu3:
    Mu50:
    MW2:
    MW1381
    RF122:
    SAB0266
    ST398:
    SAPIG0395 (xhlB)
    T0131:
    TCH60:
    HMPREF0772_11711
    TW20:
    USA300_TCH1516:
    USA300HOU_1433
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDAKVITRYIVLILALVNQFLANKGISPIPVDEESVSSIILTVVALYTTYKDNPTSQEGK
    NCTC8325        MDAKVITRYIVLILALVNQFLANKGISPIPVDEESVSSIILTVVALYTTYKDNPTSQEGK
    Newman          MDAKVITRYIVLILALVNQFLANKGISPIPVDEESVSSIILTVVALYTTYKDNPTSQEGK
    USA300_FPR3757  MDAKVITRYIVLILALVNQFLANKGISPIPVDEESVSSIILTVVALYTTYKDNPTSQEGK
                    ************************************************************

    COL             WANQKLKKYKAESKYRKATGQAPIKEVMTPTNMNDTNDLG
    NCTC8325        WANQKLKKYKAENKYRKATGQAPIKEVMTPTNMNDTNDLG
    Newman          WANQKLKKYKAESKYRKATGQAPIKEVMTPTNMNDTNDLG
    USA300_FPR3757  WANQKLKKYKAESKYRKATGQAPIKEVMTPTNMNDTNDLG
                    ************.***************************