From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001814000
  • symbol?:
  • description?: SLT orf 129-like protein

      descriptions from strain specific annotations:

    • SLT orf 129-like protein
    • phiSLT ORF129-like protein
    • phage-like protein
    • phage protein
  • strand?: -
  • coordinates?: 2249185..2249574
  • synteny block?: BlockID0011900
  • occurrence?: in 53% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    C248_0367
    11819-97:
    MS7_1450
    71193:
    ECT-R 2:
    ED133:
    SAOV_0337
    ED98:
    SAAV_2014
    HO 5096 0412:
    SAEMRSA15_13560
    JH1:
    SaurJH1_1097
    JH9:
    SaurJH9_1076
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR1501
    MSHR1132:
    MSSA476:
    SAS0950
    Mu3:
    Mu50:
    MW2:
    MW1384
    RF122:
    SAB0262
    ST398:
    SAPIG0392
    T0131:
    TCH60:
    HMPREF0772_11708
    TW20:
    USA300_TCH1516:
    USA300HOU_1435
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQILVNKRNEIISYAIIGGFEEGIDIENLPENFSQVFRPKAFKYSNGEIVFNEDYSEEKD
    NCTC8325        MQILVNKRNEIISYAIIGGFEEGIDIENLPENFSQVFRPKAFKYSNGEIVFNEDYSEEKD
    USA300_FPR3757  MQILVNKRNEIISYAIIGGFEEGIDIENLPENFSQVFRPKAFKYSNGEIVFNEDYSEEKD
                    ************************************************************

    COL             DLHQQIDSEEQNTVASDDILRKMVASMQKQVVQSTKLSMQVNKQNALMAKQLVTLNKKLE
    NCTC8325        DLHQQIDSEEQNTVASDDILRKMVASMQKQVVQSTKLSMQVNKQNALMAKQLVTLNKKLE
    USA300_FPR3757  DLHQQIDSEEQNTVASDDILRKMVASMQKQVVQSTKLSMQVNKQNALMAKQLVTLNKKLE
                    ************************************************************

    COL             EVKGETENA
    NCTC8325        EVKGETENA
    USA300_FPR3757  EVKGETENA
                    *********