From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001818000
  • symbol?:
  • description?: prophage endopeptidase tail family protein

      descriptions from strain specific annotations:

    • prophage endopeptidase tail family protein
    • phiSLT ORF527-like protein
    • phage protein
    • phi SLT phage protein
    • SLT orf 527-like protein
  • strand?: -
  • coordinates?: 2253607..2256605
  • synteny block?: BlockID0011940
  • occurrence?: in 53% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    C248_0363
    11819-97:
    MS7_1454
    71193:
    ECT-R 2:
    ED133:
    SAOV_0333
    ED98:
    SAAV_2018
    HO 5096 0412:
    SAEMRSA15_13600
    JH1:
    SaurJH1_1093
    JH9:
    SaurJH9_1072
    JKD6008:
    JKD6159:
    SAA6159_01363
    LGA251:
    M013:
    MRSA252:
    SAR1505
    MSHR1132:
    MSSA476:
    SAS0946
    Mu3:
    Mu50:
    MW2:
    MW1388
    RF122:
    ST398:
    SAPIG0388
    T0131:
    TCH60:
    HMPREF0772_11704
    TW20:
    USA300_TCH1516:
    USA300HOU_1439
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDYHDHLSVMDFNELICENLLDVDYGSFKEYYELNEARYITFTVYRTTHNSFVFDLLICE
    NCTC8325        MDYHDHLSVMDFNELICENLLDVDYGSFKEYYELNEARYITFTVYRTTHNSFVFDLLICE
    USA300_FPR3757  MDYHDHLSVMDFNELICENLLDVDYGSFKEYYELNEARYITFTVYRTTHNSFVFDLLICE
                    ************************************************************

    COL             NFIIYHGEKYTIKQTAPKVEGDKVFIEVTAYHIMYEFQNHSVESNKLDDDSSETGKTPEY
    NCTC8325        NFIIYHGEKYTIKQTAPKVEGDKVFIEVTAYHIMYEFQNHSVESNKLDDDSSETGKTPEY
    USA300_FPR3757  NFIIYHGEKYTIKQTAPKVEGDKVFIEVTAYHIMYEFQNHSVESNKLDDDSSETGKTPEY
                    ************************************************************

    COL             SLDEYLRYGFANQKTSVKMTYKIIGDFKRKVPIDELGNKNGLEYCKEAVDLFGCIIYPND
    NCTC8325        SLDEYLRYGFANQKTSVKMTYKIIGDFKRKIPIDELGNKNGLEYCKEAVDLFGCIIYPND
    USA300_FPR3757  SLDEYLRYGFANQKTSVKMTYKIIGDFKRKVPIDELGNKNGLEYCKEAVDLFGCIIYPND
                    ******************************:*****************************

    COL             TEIGFYSPETFYQRSEKVIRYQYNTDTVSATVSTLELRTAIKVFGKKYTAEEKKNYNPIR
    NCTC8325        TEICFYSPETFYQRSEKVIRYQYNTDTVSATVSTLELRTAIKVFGKKYTAEEKKNYNPIR
    USA300_FPR3757  TEIGFYSPETFYQRSEKVIRYQYNTDTVSATVSTLELRTAIKVFGKKYTAEEKKNYNPIR
                    *** ********************************************************

    COL             TTDIKYSNGFIKEGTYRTETIGSKATINFDCKYGNETVRFTIKKGSQGGIYKLILDGKQI
    NCTC8325        TTDIKYSNGFIKEGTYRTATIGSKATINFDCKYGNETVRFTIKKGSQGGIYKLILDGKQI
    USA300_FPR3757  TTDIKYSNGFIKEGTYRTETIGSKATINFDCKYGNETVRFTIKKGSQGGIYKLILDGKQI
                    ****************** *****************************************

    COL             KQISCFAKSVQSETIDLIKNIDKGKHVLEMIFLGEDPKNRIDISSNKKAKPCMYVGTEKS
    NCTC8325        KQISCFAKSVQSETIDLIKNIDKGKHVLEMIFLGEDPKNRIDISSNKKAKPCMYVGTEKS
    USA300_FPR3757  KQISCFAKSVQSETIDLIKNIDKGKHVLEMIFLGEDPKNRIDISSNKKAKPCMYVGTEKS
                    ************************************************************

    COL             TVLNLIADNSGRNQYKAIVDYVADSAKQFGIRYANTQTNEDIETQDKLLEFAKKQINDTP
    NCTC8325        TVLNLIADNSGRNQYKAIVDYVADSAKQFGIRYANTQTNEDIETQDKLLEFAKKQINDTP
    USA300_FPR3757  TVLNLIADNSGRNQYKAIVDYVADSAKQFGIRYANTQTNEDIETQDKLLEFAKKQINDTP
                    ************************************************************

    COL             KTELDVNYIGYEKIEPRDSVFFVHELMGYNTELKVVKLDRSHPFVNAIDEVSFSNEIKDM
    NCTC8325        KTELDVNYIGYEKIEPRDSVFFVHELMGYNTELKVVKLDRSHPFVNAIDEVSFSNEIKDM
    USA300_FPR3757  KTELDVNYIGYEKIEPRDSVFFVHELMGYNTELKVVKLDRSHPFVNAIDEVSFSNEIKDM
                    ************************************************************

    COL             VQIQQALNRRVIAQDNRYNYQANRINHLYTSTLNSPFETMDIGSVLI
    NCTC8325        VQIQQALNRRVIAQDNRYNYQANRINHLYTSTLNSPFETMDIGSVLI
    USA300_FPR3757  VQIQQALNRRVIAQDNRYNYQANRINHLYTSTLNSPFETMDIGSVLI
                    ***********************************************