From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN001834000
  • symbol?:
  • description?: terminase large subunit

      descriptions from strain specific annotations:

    • terminase large subunit
    • phiSLT ORF 563-like protein, terminase, large subunit
    • phage Terminase family protein
    • phage terminase
    • prophage L54a, terminase, large subunit
    • phage terminase large subunit
    • putative phage terminase, large subunit
  • strand?: -
  • coordinates?: 2279313..2286309
  • synteny block?: BlockID0012100
  • occurrence?: in 47% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    C248_0349
    11819-97:
    MS7_1468
    71193:
    ECT-R 2:
    ED133:
    ED98:
    SAAV_2032
    HO 5096 0412:
    SAEMRSA15_13740
    JH1:
    SaurJH1_1079
    JH9:
    SaurJH9_1059
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR1519
    MSHR1132:
    MSSA476:
    SAS0932
    Mu3:
    Mu50:
    MW2:
    MW1401
    RF122:
    ST398:
    SAPIG0373
    T0131:
    TCH60:
    HMPREF0772_11690
    TW20:
    USA300_TCH1516:
    USA300HOU_1453
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTIKVLNEPSPKLLTTWYAEQVTQGKIKTSKYVRKECERHLRYLENGGKWVFDEELAHRP
    NCTC8325        MTIKVLNEPSPKLLTTWYAEQVTQGKIKTSKYVKKECERHLRYLENGGKWVFDEELAHRP
    USA300_FPR3757  MTIKVLNEPSPKLLTTWYAEQVTQGKIKTSKYVKKECERHLRYLENGGKWVFDEELAHRP
                    *********************************:**************************

    COL             IRFIEKFCKPSKGSKRQLVLQPWQHFIIGSLFGWVHKETKLRRFKEALIFMGRKNGKTTT
    NCTC8325        IRFIEKFCKPSKGSKRQLVLQPWQHFIIGSLFGWVHKETKLRRFKEALIFMGRKNGKTTT
    USA300_FPR3757  IRFIEKFCKPSKGSKRQLVLQPWQHFIIGSLFGWVHKETKLRRFKEALIFMGRKNGKTTT
                    ************************************************************

    COL             ISGVANYAVSQDGENGAEIHLLANVMKQARILFDESKAMIKASPKLDKNFRTLRDEIHYD
    NCTC8325        ISGVANYAVSQDGENGAEIHLLANVMKQARILFDESKAMIKASPKLRENFRPLRDEIHYD
    USA300_FPR3757  ISGVANYAVSQDGENGAEIHLLANVMKQARILFDESKAMIKASPKLDKNFRTLRDEIHYD
                    ********************************************** :***.********

    COL             ATISKIMPQASDSDKLDGLNTHMGIFDEIHEFKDYKLISVIKNSRAARLQPLLIYITTAG
    NCTC8325        ATISKIMPQASDSDKLDGLNTHMGIFDEIHEFKDYKLISVIKNSRAARLQPLLIYITTAG
    USA300_FPR3757  ATISKIMPQASDSDKLDGLNTHMGIFDEIHEFKDYKLISVIKNSRAARLQPLLIYITTAG
                    ************************************************************

    COL             YQLDGPLVDMVEAGRDTLDQIIEDERTFYYLASLDDDDDINDSSNWIKANPNLGVSINLD
    NCTC8325        YQLDGPLVNMVEAGRDTLDRIIEDERTFYYLASLDDDDDINDSSNWIKANPNLGVSIDLA
    USA300_FPR3757  YQLDGPLVDMVEAGRDTLDQIIEDERTFYYLASLDDDDDINDSSNWIKANPNLGVSINLD
                    ********:**********:*************************************:* 

    COL             EMKEEWEKAKRTPAERGDFITKRFNIFANNDEMSFIDYPTLQKNNEIVSLEELEGRPCTI
    NCTC8325        EMKEEWEKAKRTPDERGDFITKRFNIFANNDEMSFIDYPTLQKNNDIISLDELEGRPCTI
    USA300_FPR3757  EMKEEWEKAKRTPAERGDFITKRFNIFANNDEMSFIDYPTLQKNNEIVSLEELEGRPCTI
                    ************* *******************************:*:**:*********

    COL             GYDLSETEDFTAACATFALDNGKVAVLSHSWIPKHKVEYSNEKIPYREWEEDGLLTVQDK
    NCTC8325        GYDLSETEDFTAACATFALDNGKVAVLTHSWIPKHKVEYSNEKIPYIEWEEDGLLTIQDN
    USA300_FPR3757  GYDLSETEDFTAACATFALDNGKVAVLSHSWIPKHKVEYSNEKIPYREWEEDGLLTVQDK
                    ***************************:****************** *********:**:

    COL             PYIDYQDVLNWIIKMNEHYVVEKITYDRANAFKLNQELKNYGFETEETRQGALTLSPALK
    NCTC8325        PYIDYQDVLNWIIKMNEHYVVEKITYDRANAFKLNQELKNYGFETEETRQGALTLSPALK
    USA300_FPR3757  PYIDYQDVLNWIIKMNEHYVVEKITYDRANAFKLNQELKNYGFETEETRQGALTLSPALK
                    ************************************************************

    COL             DLKEMFLDGKIIFNNNPLMKWYINNVQLKLDRNGNWLPSKQSRYRKIDGFAAFLNTYTDI
    NCTC8325        DLKEMFLDGKIIFNNNPLMKWYINNVQLKLDRNGNWLPSKQSRYRKIDGFAAFLNTYTDI
    USA300_FPR3757  DLKEMFLDGKIIFNNNPLMKWYINNVQLKLDRNGNWLPSKQSRYRKIDGFAAFLNTYTDI
                    ************************************************************

    COL             MNKVVSDSGEGNIEFISIKDIMR
    NCTC8325        MNKVVSDKGEGNIEFISIKDIMR
    USA300_FPR3757  MNKVVSDKGEGNIEFISIKDIMR
                    *******.***************