From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001851000
  • symbol?:
  • description?: alpha/beta hydrolase

      descriptions from strain specific annotations:

    • alpha/beta hydrolase
    • alpha/beta family hydrolase
    • acetyl esterase
    • esterase/lipase-like protein
  • strand?: -
  • coordinates?: 2351234..2352061
  • synteny block?: BlockID0012260
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0320
    08BA02176:
    C248_0372
    11819-97:
    MS7_0311
    71193:
    ST398NM01_0401
    ECT-R 2:
    ECTR2_281
    ED133:
    SAOV_0346c
    ED98:
    SAAV_0288
    HO 5096 0412:
    SAEMRSA15_02770
    JH1:
    SaurJH1_0380
    JH9:
    SaurJH9_0369
    JKD6008:
    SAA6008_00298
    JKD6159:
    SAA6159_00297
    LGA251:
    SARLGA251_02830
    M013:
    M013TW_0302
    MRSA252:
    SAR0318
    MSHR1132:
    SAMSHR1132_02950
    MSSA476:
    SAS0298
    Mu3:
    SAHV_0318
    Mu50:
    SAV0321
    MW2:
    MW0298
    RF122:
    SAB0271c
    ST398:
    SAPIG0401
    T0131:
    SAT0131_00326 (sbnA)
    TCH60:
    HMPREF0772_10174
    TW20:
    SATW20_03890
    USA300_TCH1516:
    USA300HOU_0341
    VC40:
    SAVC_01355

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTEIKDKVITKDAFALPYTIIKAKNQPTKGAIVYIHGGGLMFGKANDLSPQYIDILTEHY
    N315            MTEIKYKVITKDAFALPYTIIKAKNQPTKGVIVYIHGGGLMFGKANDLSPQYIDILTEHY
    NCTC8325        MTEIKDKVITKDAFALPYTIIKAKNQPTKGAIVYIHGGGLMFGKANDLSPQYIDILTEHY
    Newman          MTEIKDKVITKDAFALPYTIIKAKNQPTKGAIVYIHGGGLMFGKANDLSPQYIDILTEHY
    USA300_FPR3757  MTEIKDKVITKDAFALPYTIIKAKNQPTKGAIVYIHGGGLMFGKANDLSPQYIDILTEHY
                    ***** ************************.*****************************

    COL             DLIQLSYRLLPEVSLDCIIEDVYASFDAIQSQYSNCPIFTFGRSSGAYLSLLIARDRDID
    N315            DLIQLSYRLLPEVSLDCIIEDVYASFDAIQSQYSNCPIFTFGRSSGAYLSLLIARDRDID
    NCTC8325        DLIQLSYRLLPEVSLDCIIEDVYASFDAIQSQYSNCPIFTFGRSSGAYLSLLIARDRDID
    Newman          DLIQLSYRLLPEVSLDCIIEDVYASFDAIQSQYSNCPIFTFGRSSGAYLSLLIARDRDID
    USA300_FPR3757  DLIQLSYRLLPEVSLDCIIEDVYASFDAIQSQYSNCPIFTFGRSSGAYLSLLIARDRDID
                    ************************************************************

    COL             GVIDFYGYSRINTEPFKTTNSYYAKIAQSVNETMIAQLTSPTPVVQDQIAQRFLIYVYAR
    N315            GVIDFYGYSRINTEPFKTTNSYYAKIAQSINETMIAQLTSPTPVVQDQIAQRFLIYVYAR
    NCTC8325        GVIDFYGYSRINTEPFKTTNSYYAKIAQSVNETMIAQLTSPTPVVQDQIAQRFLIYVYAR
    Newman          GVIDFYGYSRINTEPFKTTNSYYAKIAQSVNETMIAQLTSPTPVVQDQIAQRFLIYVYAR
    USA300_FPR3757  GVIDFYGYSRINTEPFKTTNSYYAKIAQSVNETMIAQLTSPTPVVQDQIAQRFLIYVYAR
                    *****************************:******************************

    COL             GTGKWINMINIADYTNSKYNIAPDELKTLPPVFIAHCNGDYDVPVEESEHIMNHVPHSTF
    N315            GTGKWINMINIADYTDSKYNIAPDELKTLPPVFIAHCNGDYDVPVEESEHIMNHVPHSTF
    NCTC8325        GTGKWINMINIADYTNSKYNIAPDELKTLPPVFIAHCNGDYDVPVEESEHIMNHVPHSTF
    Newman          GTGKWINMINIADYTNSKYNIAPDELKTLPPVFIAHCNGDYDVPVEESEHIMNHVPHSTF
    USA300_FPR3757  GTGKWINMINIADYTNSKYNIAPDELKTLPPVFIAHCNGDYDVPVEESEHIMNHVPHSTF
                    ***************:********************************************

    COL             ERVNKNEHDFDRRPNDEAITIYRKVVDFLNAITMM
    N315            ERVNKNEHDFDRRPNDEAITIYRKVVDFLNAITMV
    NCTC8325        ERVNKNEHDFDRRPNDEAITIYRKVVDFLNAITMM
    Newman          ERVNKNEHDFDRRPNDEAITIYRKVVDFLNAITMM
    USA300_FPR3757  ERVNKNEHDFDRRPNDEAITIYRKVVDFLNAITMM
                    **********************************: