From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001852000
  • symbol?:
  • description?: NADH-dependent flavin oxidoreductase

      descriptions from strain specific annotations:

    • NADH-dependent flavin oxidoreductase
    • Oye family NADH-dependent flavin oxidoreductase
    • NADH-dependent flavin oxidoreductase Oye family protein
    • NADH:flavin oxidoreductase / NADH oxidase family protein
    • FMN reductase
    • NADH:flavin oxidoreductase
    • putative NADH-dependent flavin oxidoreductase
    • trimethylamine dehydrogenase
  • strand?: -
  • coordinates?: 2352120..2352812
  • synteny block?: BlockID0012270
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0321 (yqiG)
    08BA02176:
    C248_0373
    11819-97:
    MS7_0312
    71193:
    ST398NM01_0402
    ECT-R 2:
    ECTR2_282
    ED133:
    SAOV_0347c
    ED98:
    SAAV_0289
    HO 5096 0412:
    SAEMRSA15_02780
    JH1:
    SaurJH1_0381
    JH9:
    SaurJH9_0370
    JKD6008:
    SAA6008_00299
    JKD6159:
    SAA6159_00298
    LGA251:
    SARLGA251_02840
    M013:
    M013TW_0303
    MRSA252:
    SAR0319
    MSHR1132:
    SAMSHR1132_02960
    MSSA476:
    SAS0299
    Mu3:
    SAHV_0319
    Mu50:
    SAV0322
    MW2:
    MW0299
    RF122:
    SAB0272c
    ST398:
    SAPIG0402
    T0131:
    SAT0131_00327
    TCH60:
    HMPREF0772_10173
    TW20:
    SATW20_03900
    USA300_TCH1516:
    USA300HOU_0342
    VC40:
    SAVC_01360

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYRYKPLLQSIHLPNGIKISNRFVLSPMTVNTSTKEGYITKEDLAYAARRSNSAGMQVTG
    N315            MYRYKPLLQSIHLPNGIKISNRFVLSPMTVNASTKEGYITKADLAYAARRSNSAGMQVTG
    NCTC8325        MYRYKPLLQSIHLPNGIKISNRFVLSPMTVNTSTKEGYITKEDLAYAARRSNSAGMQVTG
    Newman          MYRYKPLLQSIHLPNGIKISNRFVLSPMTVNTSTKEGYITKEDLAYAARRSNSAGMQVTG
    USA300_FPR3757  MYRYKPLLQSIHLPNGIKISNRFVLSPMTVNTSTKEGYITKEDLAYAARRSNSAGMQVTG
                    *******************************:********* ******************

    COL             AAYIEPYGQLFEYGFNIDHDACIPGLTNMASTMKQHGSLAIIQLAHAGRFSNQAILNFGK
    N315            AAYIEPYGKLFEYGFNIDHDACIPGLTNMASTMKQHGSLAIIQLAHAGRFSNQAILNFGK
    NCTC8325        AAYIEPYGQLFEYGFNIDHDACIPGLTNMASTMKQHGSLAIIQLAHAGRFSNQAILNFGK
    Newman          AAYIEPYGQLFEYGFNIDHDACIPGLTNMASTMKQHGSLAIIQLAHAGRFSNQAILNFGK
    USA300_FPR3757  AAYIEPYGQLFEYGFNIDHDACIPGLTNMASTMKQHGSLAIIQLAHAGRFSNQAILNFGK
                    ********:***************************************************

    COL             VYGPSPMTLHSPIEHDVIAMSHEKINSIIQQYRDATLRAIKAGFDGVEISIAQRLLIQTF
    N315            VYGPSPMTLHSPIEHVVIAMSHEKINSIIQQYRDATLRAIKAGFDGVEISIAQRLLIQTF
    NCTC8325        VYGPSPMTLHSPIEHDVIAMSHEKINSIIQQYRDATLRAIKAGFDGVEISIAQRLLIQTF
    Newman          VYGPSPMTLHSPIEHDVIAMSHEKINSIIQQYRDATLRAIKAGFDGVEISIAQRLLIQTF
    USA300_FPR3757  VYGPSPMTLHSPIEHDVIAMSHEKINSIIQQYRDATLRAIKAGFDGVEISIAQRLLIQTF
                    *************** ********************************************

    COL             FSTFSNKRTDHYGADSLKNRARLCLEVMRAVQEVIDKEAPDNFILGFRATPEETRGSDLG
    N315            FSTFSNRRTDHYGADSLKNRARLCLEVMRAVQEVIDKEAPDNFILGFRATPEETRGSDLG
    NCTC8325        FSTFSNKRTDHYGADSLKNRARLCLEVMRAVQEVIDKEAPDNFILGFRATPEETRGSDLG
    Newman          FSTFSNKRTDHYGADSLKNRARLCLEVMRAVQEVIDKEAPDNFILGFRATPEETRGSDLG
    USA300_FPR3757  FSTFSNKRTDHYGADSLKNSARLCLEVMRAVQEVIDKEAPDNFILGFRATPEETRGSDLG
                    ******:************ ****************************************

    COL             YTIDEFNQLINWVMDVSNIQYLAIASWGRHIYQNTSRTPGDHFGRPVNQIVYEHLAGRIP
    N315            YTIDEFNQLIDWVMDVSNIQYLAIASWGRHIYQNTSRTPGDHFGRPVNQIVYEHLAGRIP
    NCTC8325        YTIDEFNQLINWVMDVSNIQYLAIASWGRHIYQNTSRTPGDHFGRPVNQIVYEHLAGRIP
    Newman          YTIDEFNQLINWVMDVSNIQYLAIASWGRHIYQNTSRTPGDHFGRPVNQIVYEHLAGRIP
    USA300_FPR3757  YTIDEFNQLINWVMDVSDIQYLAIASWGRHIYQNTSRTPGDHFGRPVNQIVYEHLAGRIP
                    **********:******:******************************************

    COL             LIASGGINSPESALDALQHADMVGMSSPFVTEPDFVHKLAEQRPHDINLEFSMADLEDLA
    N315            LIASGGINSPESALDALQHADMVGMSSPFVTEPDFVHKLAEQRPHDINLEFSMADLEDLA
    NCTC8325        LIASGGINSPESALDALQHADMVGMSSPFVTEPDFVHKLAEQRPHDINLEFSMADLEDLA
    Newman          LIASGGINSPESALDALQHADMVGMSSPFVTEPDFVHKLAEQRPHDINLEFSMADLEDLA
    USA300_FPR3757  LIASGGINSPESALDALQHADMVGMSSPFVTEPDFVHKLAEQRPHDINLEFSMADLEDLA
                    ************************************************************

    COL             IPHAAFKDIVKMMDYGEGLKKHTRDALRQLEQNYHDSSS
    N315            IPHAAFKDIVKMMDYGEGLKKHTRDALRQLEQNYHDSSS
    NCTC8325        IPHAAFKDIVKMMDYGEGLKKHTRDALRQLEQNYHDSSS
    Newman          IPHAAFKDIVKMMDYGEGLKKHTRDALRQLEQNYHDSSS
    USA300_FPR3757  IPHAAFKDIVKMMDYGEGLKKHTRDALRQLEQNYHDSSS
                    ***************************************