From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001863000
  • symbol?: ulaA
  • description?: PTS system ascorbate-specific transporter subunit IIC

      descriptions from strain specific annotations:

    • PTS system ascorbate-specific transporter subunit IIC
    • PTS ascorbate transporter subunit IIC
    • ascorbate-specific PTS system enzyme IIC
    • PTS family ascorbate porter, IIC component
    • PTS system ascorbate-specific IIC component
    • PTS system sugar-specific permease component family protein
    • putative integral membrane protein
    • sugar-specific permease, SgaT/UlaA family protein
    • transport protein
  • strand?: -
  • coordinates?: 2359274..2360620
  • synteny block?: BlockID0012370
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0400 (ulaA)
    N315:
    SA0318 (ulaA)
    NCTC8325:
    Newman:
    NWMN_0322 (ulaA)
    USA300_FPR3757:
    04-02981:
    SA2981_0328 (sgaT)
    08BA02176:
    C248_0383 (ulaA)
    11819-97:
    MS7_0319
    71193:
    ST398NM01_0410
    ECT-R 2:
    ECTR2_289
    ED133:
    SAOV_0354c
    ED98:
    SAAV_0297 (ulaA)
    HO 5096 0412:
    SAEMRSA15_02850
    JH1:
    SaurJH1_0388 (ulaA)
    JH9:
    SaurJH9_0378 (ulaA)
    JKD6008:
    SAA6008_00306 (ulaA)
    JKD6159:
    SAA6159_00304 (ulaA)
    LGA251:
    SARLGA251_02900
    M013:
    M013TW_0309
    MRSA252:
    SAR0326 (ulaA)
    MSHR1132:
    SAMSHR1132_03030
    MSSA476:
    SAS0306 (ulaA)
    Mu3:
    SAHV_0326 (ulaA)
    Mu50:
    SAV0329 (ulaA)
    MW2:
    MW0306 (ulaA)
    RF122:
    SAB0278c (ulaA)
    ST398:
    SAPIG0410
    T0131:
    SAT0131_00334
    TCH60:
    HMPREF0772_10166 (ulaA)
    TW20:
    SATW20_03970
    USA300_TCH1516:
    USA300HOU_0350 (ulaA)
    VC40:
    SAVC_01395 (ulaA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQAILNFIVDILSQPAILVALIAFIGLIVQKKPAATITSGTIKTILGFLILSAGADVVVR
    N315            MQAILNFIVDILSQPAILVALIAFIGLIVQKKPAATITSGTIKTILGFLILSAGADVVVR
    NCTC8325        MQAILNFIVDILSQPAILVALIAFIGLIVQKKPAATITSGTIKTILGFLILSAGADVVVR
    Newman          MQAILNFIVDILSQPAILVALIAFIGLIVQKKPAATITSGTIKTILGFLILSAGADVVVR
    USA300_FPR3757  MQAILNFIVDILSQPAILVALIAFIGLIVQKKPAATITSGTIKTILGFLILSAGADVVVR
                    ************************************************************

    COL             SLEPFGKIFQHAFGVQGILPNNEAIVSLALKDFGTTAALIMVCGMIVNILIARFTNLKYI
    N315            SLEPFGKIFQHAFGVQGIVPNNEAIVSLALKDFGTTAALIMVCGMIVNILIARFTNLKYI
    NCTC8325        SLEPFGKIFQHAFGVQGIVPNNEAIVSLALKDFGTTAALIMVCGMIVNILIARFTNLKYI
    Newman          SLEPFGKIFQHAFGVQGIVPNNEAIVSLALKDFGTTAALIMVCGMIVNILIARFTNLKYI
    USA300_FPR3757  SLEPFGKIFQHAFGVQGIVPNNEAIVSLALKDFGTTAALIMVCGMIVNILIARFTNLKYI
                    ******************:*****************************************

    COL             FLTGHHTFYMAAFLAIILTVSHIKGWLTIVIGALVLGLIMAVLPALLQPTMRKITGNDQV
    N315            FLTGHHTFYMAAFLAIILTVSHIKGWLTIVIGALVLGLIMAVLPALLQPTMRKITGNDQV
    NCTC8325        FLTGHHTFYMAAFLAIILTVSHIKGWLTIVIGALVLGLIMAVLPALLQPTMRKITGNDQV
    Newman          FLTGHHTFYMAAFLAIILTVSHIKGWLTIVIGALVLGLIMAVLPALLQPTMRKITGNDQV
    USA300_FPR3757  FLTGHHTFYMAAFLAIILTVSHIKGWLTIVIGALVLGLIMAVLPALLQPTMRKITGNDQV
                    ************************************************************

    COL             ALGHFGSISYFAAGAVGQLFKGKSKSTEEIKFPKGLSFLRESTISISITMALLYFIACLF
    N315            ALGHFGSISYFAAGAVGQLFKGKSKSTEEIKFPKGLSFLRESTISISITMALLYFIACLF
    NCTC8325        ALGHFGSISYFAAGAVGQLFKGKSKSTEEIKFPKGLSFLRESTISISITMALLYFIACLF
    Newman          ALGHFGSISYFAAGAVGQLFKGKSKSTEEIKFPKGLSFLRESTISISITMALLYFIACLF
    USA300_FPR3757  ALGHFGSISYFAAGAVGQLFKGKSKSTEEIKFPKGLSFLRESTISISITMALLYFIACLF
                    ************************************************************

    COL             AGVSYVHESISDGQNFIVFSLIQGVTFAAGVFIILTGVRLILAEIVPAFKGISEKLVPNS
    N315            AGVSYVHESISDGQNFIVFSLIQGVTFAAGVFIILTGVRLILAEIVPAFKGISEKLVPNS
    NCTC8325        AGVSYVHESISDGQNFIVFSLIQGVTFAAGVFIILTGVRLILAEIVPAFKGISEKLVPNS
    Newman          AGVSYVHESISDGQNFIVFSLIQGVTFAAGVFIILTGVRLILAEIVPAFKGISEKLVPNS
    USA300_FPR3757  AGVSYVHESISDGQNFIVFSLIQGVTFAAGVFIILTGVRLILAEIVPAFKGISEKLVPNS
                    ************************************************************

    COL             KPALDCPIVFPYAQNAVLIGFFVSFITGVIGMFILFLFGGVVILPGVVAHFFLGATAAVF
    N315            KPALDCPIVFPYAQNAVLIGFFVSFITGVIGMFILFLFGGVVILPGVVAHFFLGATAAVF
    NCTC8325        KPALDCPIVFPYAQNAVLIGFFVSFITGVIGMFILFLFGGVVILPGVVAHFFLGATAAVF
    Newman          KPALDCPIVFPYAQNAVLIGFFVSFITGVIGMFILFLFGGVVILPGVVAHFFLGATAAVF
    USA300_FPR3757  KPALDCPIVFPYAQNAVLIGFFVSFITGVIGMFILFLFGGVVILPGVVAHFFLGATAAVF
                    ************************************************************

    COL             GNARGGIKGAIAGAALNGILITFLPLLFLPFLGELGGAATTFSDTDFLAVGIVFGNAVKY
    N315            GNARGGIKGAVAGAALNGILITFLPLLFLPFLGELGGAATTFSDTDFLTVGIVFGNAVKY
    NCTC8325        GNARGGIKGAIAGAALNGILITFLPLLFLPFLGELGGAATTFSDTDFLAVGIVFGNAVKY
    Newman          GNARGGIKGAIAGAALNGILITFLPLLFLPFLGELGGAATTFSDTDFLAVGIVFGNAVKY
    USA300_FPR3757  GNARGGIKGAIAGAALNGILITFLPLLFLPFLGELGGAATTFSDTDFLAVGIVFGNAVKY
                    **********:*************************************:***********

    COL             MGLFGAILFIIIVGATTILLKGRQKEQQ
    N315            MGLFGAILFIIIVGATAILLKGRQKPQQ
    NCTC8325        MGLFGAILFIIIVGATTILLKGRQKEQQ
    Newman          MGLFGAILFIIIVGATTILLKGRQKEQQ
    USA300_FPR3757  MGLFGAILFIIIVGATTILLKGRQKEQQ
                    ****************:******** **