From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001865000
  • symbol?:
  • description?: PTS ascorbate transporter subunit IIA

      descriptions from strain specific annotations:

    • PTS ascorbate transporter subunit IIA
    • PTS system, IIA component
    • phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 family protein
    • phosphoenolpyruvate-dependent sugar phosphotransferase system EIIA 2
    • PTS family porter component IIA
    • PTS system component
    • PTS system mannitol-specific transporter subunit IIA
    • PTS system transporter subunit IIA
    • PTS transporter subunit IIA-like nitrogen-regulatory protein PtsN
    • PTS transport system ascorbate-specific transporter subunit IIA
    • PTS transport system IIA component
    • putative PTS transport system IIA component
    • transcription antiterminator, BglG family
  • strand?: -
  • coordinates?: 2360921..2361364
  • synteny block?: BlockID0012390
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0330
    08BA02176:
    C248_0385
    11819-97:
    MS7_0321
    71193:
    ST398NM01_0412
    ECT-R 2:
    ECTR2_291
    ED133:
    SAOV_0356c
    ED98:
    SAAV_0299
    HO 5096 0412:
    SAEMRSA15_02870
    JH1:
    SaurJH1_0390
    JH9:
    SaurJH9_0380
    JKD6008:
    SAA6008_00308
    JKD6159:
    SAA6159_00306
    LGA251:
    SARLGA251_02920
    M013:
    M013TW_0311
    MRSA252:
    SAR0328
    MSHR1132:
    SAMSHR1132_03050
    MSSA476:
    SAS0308
    Mu3:
    SAHV_0328
    Mu50:
    SAV0331
    MW2:
    MW0308
    RF122:
    SAB0280c
    ST398:
    SAPIG0412
    T0131:
    SAT0131_00336
    TCH60:
    HMPREF0772_10164
    TW20:
    SATW20_03990
    USA300_TCH1516:
    USA300HOU_0352
    VC40:
    SAVC_01405

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSLDILSTTRIIVKEQVNDWTEAITIASQPLLQEQIIEQGYVQAMIDSVNELGPYIVIAP
    N315            MSLDILSTTRIIVKEQVNDWTEAITIASQPLLQEQIIEQGYVQAMIDSVNELGPYIVIAP
    NCTC8325        MSLDILSTTRIIVKEQVNDWTEAITIASQPLLQEQIIEQGYVQAMIDSVNELGPYIVIAP
    Newman          MSLDILSTTRIIVKEQVNDWTEAITIASQPLLQEQIIEQGYVQAMIDSVNELGPYIVIAP
    USA300_FPR3757  MSLDILSTTRIIVKEQVNDWTEAITIASQPLLQEQIIEQGYVQAMIDSVNELGPYIVIAP
                    ************************************************************

    COL             EIAIAHARPNNDVHQVGLSLLKLNQHVAFCDEDHYASLIFVLSAIDNHSHLSVLQNLATV
    N315            EIAIAHARPNNDVHQVGLSLLKLNQHVAFCDEDHYASLIFVLSAIDNHSHLSVLQNLATV
    NCTC8325        EIAIAHARPNNDVHQVGLSLLKLNQHVAFCDEDHYASLIFVLSAIDNHSHLSVLQNLATV
    Newman          EIAIAHARPNNDVHQVGLSLLKLNQHVAFCDEDHYASLIFVLSAIDNHSHLSVLQNLATV
    USA300_FPR3757  EIAIAHARPNNDVHQVGLSLLKLNQHVAFCDEDHYASLIFVLSAIDNHSHLSVLQNLATV
                    ************************************************************

    COL             LGDNQTVQQLLTATNAQDIKNILKEHD
    N315            LGDNQTVQQLLTAKNAQDIKNILKEHD
    NCTC8325        LGDNQTVQQLLTATNAQDIKNILKEHD
    Newman          LGDNQTVQQLLTATNAQDIKNILKEHD
    USA300_FPR3757  LGDNQTVQQLLTATNAQDIKNILKEHD
                    *************.*************