From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001870000
  • symbol?: mepB
  • description?: mepB family protein

      descriptions from strain specific annotations:

    • mepB family protein
    • MATE family multidrug efflux pump protein
  • strand?: +
  • coordinates?: 2365528..2365944
  • synteny block?: BlockID0012440
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0334
    08BA02176:
    C248_0390
    11819-97:
    MS7_0325
    71193:
    ST398NM01_0416
    ECT-R 2:
    ECTR2_295
    ED133:
    SAOV_0360
    ED98:
    SAAV_0303
    HO 5096 0412:
    SAEMRSA15_02910
    JH1:
    SaurJH1_0394
    JH9:
    SaurJH9_0384
    JKD6008:
    SAA6008_00312 (mepB)
    JKD6159:
    SAA6159_00310 (mepB)
    LGA251:
    SARLGA251_02960 (mepB)
    M013:
    M013TW_0315
    MRSA252:
    SAR0332
    MSHR1132:
    SAMSHR1132_03090
    MSSA476:
    SAS0312
    Mu3:
    SAHV_0332
    Mu50:
    SAV0335
    MW2:
    MW0312
    RF122:
    SAB0285
    ST398:
    SAPIG0416
    T0131:
    SAT0131_00340 (hemB)
    TCH60:
    HMPREF0772_10160
    TW20:
    SATW20_04030 (mepB)
    USA300_TCH1516:
    USA300HOU_0356
    VC40:
    SAVC_01425

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MCKSKILLKNIFSEESEVKDLTEEKYNQDYEALTFSFKEETYQSRLAKKTPTKSGYFVTC
    N315            MYKSKILLKYIFSEESEVKDLTEEKYNQDYEALTFSFKEETYQSRLAKKTPTKAGYFVTC
    NCTC8325        MCKSKILLKNIFSEESEVKDLTEEKYNQDYEALTFSFKEETYQSRLAKKTPTKSGYFVTC
    Newman          MCKSKILLKNIFSEESEVKDLTEEKYNQDYEALTFSFKEETYQSRLAKKTPTKSGYFVTC
    USA300_FPR3757  MCKSKILLKNIFSEESEVKDLTEEKYNQDYEALTFSFKEETYQSRLAKKTPTKSGYFVTC
                    * ******* *******************************************:******

    COL             WTKDEDNYNRPYKIEEFADYLIVAVIDDELNGYFLFPRELLVEKGILASSKYQGKMAFRV
    N315            WTKDENNCNQPYSKEAFADYLMIIVIDEELSGYFLFPRELLVEKGILTTFEHKGKMAFRV
    NCTC8325        WTKDEDNYNRPYKIEEFADYLIVAVIDDELNGYFLFPRELLVEKGILASSKYQGKMAFRV
    Newman          WTKDEDNYNRPYKIEEFADYLIVAVIDDELNGYFLFPRELLVEKGILASSKYQGKMAFRV
    USA300_FPR3757  WTKDEDNYNRPYKIEEFADYLIVAVIDDELNGYFLFPRELLVEKGILASSKYQGKMAFRV
                    *****:* *:**. * *****:: ***:**.****************:: :::*******

    COL             YPKWCNQLNKTAGQTQKWQCKYFFEY------
    N315            YPKWCNQLNKTAGQTQKWQCKYFLNTNKKSYG
    NCTC8325        YPKWCNQLNKTAGQTQKWQCKYFFEY------
    Newman          YPKWCNQLNKTAGQTQKWQCKYFFEY------
    USA300_FPR3757  YPKWCNQLNKTAGQTQKWQCKYFFEY------
                    ***********************::