From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001874000
  • symbol?:
  • description?: glyoxalase family protein

      descriptions from strain specific annotations:

    • glyoxalase family protein
    • glyoxalase/bleomycin resistance protein/dioxygenase
    • Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily
    • glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein
    • putative dioxygenase
    • lactoylglutathione lyase
    • pseudogene
    • glyoxylase family protein
  • strand?: +
  • coordinates?: 2367710..2368639
  • synteny block?: BlockID0012480
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0336
    08BA02176:
    C248_0392
    11819-97:
    MS7_0327
    71193:
    ST398NM01_0418
    ECT-R 2:
    ECTR2_297
    ED133:
    SAOV_0362
    ED98:
    SAAV_0305
    HO 5096 0412:
    SAEMRSA15_02930
    JH1:
    SaurJH1_0396
    JH9:
    SaurJH9_0386
    JKD6008:
    SAA6008_00314
    JKD6159:
    SAA6159_00312
    LGA251:
    SARLGA251_02980
    M013:
    M013TW_0317
    MRSA252:
    SAR0334
    MSHR1132:
    SAMSHR1132_03110
    MSSA476:
    SAS0314
    Mu3:
    SAHV_0335
    Mu50:
    SAV0338
    MW2:
    MW0314
    RF122:
    SAB0287
    ST398:
    SAPIG0418
    T0131:
    SAT0131_00342 (hemD)
    TCH60:
    HMPREF0772_10158 (gloA)
    TW20:
    SATW20_04050
    USA300_TCH1516:
    USA300HOU_0358
    VC40:
    SAVC_01435

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNIVGHHHISMYTKDAKRNKDFYTNVLGLRLVEKSVNQDNPSMYHLFYGDEVGTAGTILS
    N315            MNIVGHHHISMYTKDAKRNKDFYTNVLGLRLVEKSVNQDNPSMYHLFYGDEVGTAGTILS
    NCTC8325        MNIVGHHHISMYTKDAKRNKDFYTNVLGLRLVEKSVNQDNPSMYHLFYGDEVGTAGTILS
    Newman          MNIVGHHHISMYTKDAKRNKDFYTNVLGLRLVEKSVNQDNPSMYHLFYGDEVGTAGTILS
    USA300_FPR3757  MNIVGHHHISMYTKDAKRNKDFYTNVLGLRLVEKSVNQDNPSMYHLFYGDEVGTAGTILS
                    ************************************************************

    COL             FFEIPNAGHKQPGTETIYRFSLLVPNQAALHYFEKRLENNGIKSERLYYLGQEGVVFKDE
    N315            FFEIPHAGHKQPGTETIYRFSLLVPNQAALHYFEKRLDNNGITSERLYYLGQEGVVFKDE
    NCTC8325        FFEIPNAGHKQPGTETIYRFSLLVPNQAALHYFEKRLENNGIKSERLYYLGQEGVVFKDE
    Newman          FFEIPNAGHKQPGTETIYRFSLLVPNQAALHYFEKRLENNGIKSERLYYLGQEGVVFKDE
    USA300_FPR3757  FFEIPNAGHKQPGTETIYRFSLLVPNQAALHYFEKRLENNGIKSERLYYLGQEGVVFKDE
                    *****:*******************************:****.*****************

    COL             DDLEIILLVNDSFEVPHQWQHNAYSEIPQAYQILGIGPVELRVRNAARTVEFLENVLGYR
    N315            DDLEIILLVNDSFEVPHQWQHNAYSEIPQVYQILGIGPVELRVRNAARTVEFLENVLGYR
    NCTC8325        DDLEIILLVNDSFEVPHQWQHNAYSEIPQAYQILGIGPVELRVRNAARTVEFLENVLGYR
    Newman          DDLEIILLVNDSFEVPHQWQHNAYSEIPQAYQILGIGPVELRVRNAARTVEFLENVLGYR
    USA300_FPR3757  DDLEIILLVNDSFEVPHQWQHNAYSEIPQAYQILGIGPVELRVRNAARTVEFLENVLGYR
                    *****************************.******************************

    COL             KRDNKSFDVLTLAPQGLYSDFVVIEQQGQRERPGRGYIHHIAVNTPQMSDLDAIYKKLQQ
    N315            KRDNKSFDVLTLAPQGLYSDFVVIEQQGQRERPGRGYIHHIAINTPQMSDLDAIYKKLQQ
    NCTC8325        KRDNKSFDVLTLAPQGLYSDFVVIEQQGQRERPGRGYIHHIAVNTPQMSDLDAIYKKLQQ
    Newman          KRDNKSFDVLTLAPQGLYSDFVVIEQQGQRERPGRGYIHHIAVNTPQMSDLDAIYKKLQQ
    USA300_FPR3757  KRDNKSFDVLTLAPQGLYSDFVVIEQQGQRERPGRGYIHHIAVNTPQMSDLDAIYKKLQQ
                    ******************************************:*****************

    COL             QPQSNSGIIDRYFFKSLYYRHNSIMYEFATEAPGFTIDTPVEQLGS--------------
    N315            QTQSNSGIIDRYFFKSLYYRHNSIMYEFATEAPGFTIDTPLEQLGSQLNLPDFLEAEREQ
    NCTC8325        QPQSNSGIIDRYFFKSLYYRHNSIMYEFATEAPGFTIDTPVEQLGSQLNLPDFLEAEREQ
    Newman          QPQSNSGIIDRYFFKSLYYRHNSIMYEFATEAPGFTIDTPVEQLGSQLNLPDFLEAEREQ
    USA300_FPR3757  QPQSNSGIIDRYFFKSLYYRHNSIMYEFATEAPGFTIDTPVEQLGSQLNLPDFLEAEREQ
                    *.**************************************:*****              

    COL             --------
    N315            IESKLHEI
    NCTC8325        IESKLHEI
    Newman          IESKLHEI
    USA300_FPR3757  IESKLHEI