From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001876000
  • symbol?:
  • description?: FMN reductase

      descriptions from strain specific annotations:

    • FMN reductase
    • NADH-dependent fmn reductase
    • NADPH-dependent FMN reductase, putative, FMN reductase
    • NADPH-dependent FMN reductase family protein
    • FMN reductase-related protein
    • FMN reductase-like protein
    • pseudogene
    • NADH-dependent FMN reductase (pseudogene)
  • strand?: +
  • coordinates?: 2369734..2370360
  • synteny block?: BlockID0012500
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0338
    08BA02176:
    C248_0394
    11819-97:
    MS7_0329
    71193:
    ST398NM01_0420
    ECT-R 2:
    ECTR2_299
    ED133:
    SAOV_0364
    ED98:
    SAAV_0307
    HO 5096 0412:
    SAEMRSA15_02950
    JH1:
    SaurJH1_0398
    JH9:
    SaurJH9_0388
    JKD6008:
    SAA6008_00316
    JKD6159:
    SAA6159_00314
    LGA251:
    SARLGA251_03000
    M013:
    M013TW_0319
    MRSA252:
    SAR0336
    MSHR1132:
    SAMSHR1132_03130
    MSSA476:
    SAS0316
    Mu3:
    SAHV_0337
    Mu50:
    SAV0340
    MW2:
    MW0316
    RF122:
    SAB0289
    ST398:
    SAPIG0420
    T0131:
    SAT0131_00344
    TCH60:
    HMPREF0772_10155
    TW20:
    SATW20_04070
    USA300_TCH1516:
    USA300HOU_0360
    VC40:
    SAVC_01445

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNIVLLSGSTVGSKTRIAMDDLKNELEVINEGHQIELMDLRELELEFSVGKNYLDTTGDV
    N315            MNIVLLSGSTVGSKTRIAMDDLKNELEVINEGHQIELMDLRELELEFSVGKNYLDTTGDV
    NCTC8325        MNIVLLSGSTVGSKTRIAMDDLKNELEVINEGHQIELMDLRELELEFSVGKNYLDTTGDV
    Newman          MNIVLLSGSTVGSKTRIAMDDLKNELEVINEGHQIELMDLRELELEFSVGKNYLDTTGDV
    USA300_FPR3757  MNIVLLSGSTVGSKTRIAMDDLKNELEVINEGHQIELMDLRELELEFSVGKNYLDTTGDV
                    ************************************************************

    COL             YKLTTSLMQADVIFIGFPIFQASIPGALKNVFDLLPVNAFRDKVIGLVATAGSSKHYLIP
    N315            YKLTTSLMQADVIFIGFPIFQASIPGALKNVFDLLPVNAFRDKVIGLVATAGSSKHYLIP
    NCTC8325        YKLTTSLMQADVIFIGFPIFQASIPGALKNVFDLLPVNAFRDKVIGLVATAGSSKHYLIP
    Newman          YKLTTSLMQADVIFIGFPIFQASIPGALKNVFDLLPVNAFRDKVIGLVATAGSSKHYLIP
    USA300_FPR3757  YKLTTSLMQADVIFIGFPIFQASIPGALKNVFDLLPVNAFRDKVIGLVATAGSSKHYLIP
                    ************************************************************

    COL             EMHLKPILSYMKAHTMQTYVFIEEKDFSNQQIVNDDVVFRLKALAQSTMRTAKVQQQVFE
    N315            EMHLKPILSYMKAHTMQTYVFIEEKDFSNQQIVNDDVVFRLKALAQFTMRTAKVQQQVFE
    NCTC8325        EMHLKPILSYMKAHTMQTYVFIEEKDFSNQQIVNDDVVFRLKALAQSTMRTAKVQQQVFE
    Newman          EMHLKPILSYMKAHTMQTYVFIEEKDFSNQQIVNDDVVFRLKALAQSTMRTAKVQQQVFE
    USA300_FPR3757  EMHLKPILSYMKAHTMQTYVFIEEKDFSNQQIVNDDVVFRLKALAQSTMRTAKVQQQVFE
                    ********************************************** *************

    COL             EENNQYDF
    N315            EENNQYDF
    NCTC8325        EENNQYDF
    Newman          EENNQYDF
    USA300_FPR3757  EENNQYDF
                    ********