From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001878000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • Putative membrane protein YeiH
    • glyoxalase family protein
    • membrane spanning protein
  • strand?: -
  • coordinates?: 2370420..2371415
  • synteny block?: BlockID0012520
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0339 (yeiH)
    08BA02176:
    C248_0395
    11819-97:
    MS7_0330
    71193:
    ST398NM01_0421
    ECT-R 2:
    ECTR2_300
    ED133:
    SAOV_0365c
    ED98:
    SAAV_0308
    HO 5096 0412:
    SAEMRSA15_02960
    JH1:
    SaurJH1_0399
    JH9:
    SaurJH9_0389
    JKD6008:
    SAA6008_00317
    JKD6159:
    SAA6159_00315
    LGA251:
    SARLGA251_03010
    M013:
    M013TW_0320
    MRSA252:
    SAR0338
    MSHR1132:
    SAMSHR1132_03140
    MSSA476:
    SAS0317
    Mu3:
    SAHV_0338
    Mu50:
    SAV0341
    MW2:
    MW0317
    RF122:
    SAB0290c
    ST398:
    SAPIG0421
    T0131:
    SAT0131_00345
    TCH60:
    HMPREF0772_10154
    TW20:
    SATW20_04080
    USA300_TCH1516:
    USA300HOU_0361
    VC40:
    SAVC_01450

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MASLKNKHFMIGLSLTFIVALFSFLAAKLPILDKVGALTIAILIAILYRHFRGYPEQYSS
    N315            MASLKNKHFMIGLSLTFIVALFSFLAAKLPILDKVGALTIAILIAILYRHFRGYPEQYSS
    NCTC8325        MASLKNKHFMIGLSLTFIVALFSFLAAKLPILDKVGALTIAILIAILYRHFRGYPEQYSS
    Newman          MASLKNKHFMIGLSLTFIVALFSFLAAKLPILDKVGALTIAILIAILYRHFRGYPEQYSS
    USA300_FPR3757  MASLKNKHFMIGLSLTFIVALFSFLAAKLPILDKVGALTIAILIAILYRHFRGYPEQYSS
                    ************************************************************

    COL             GITFSSKYLLRFAIILYGLKLNIFDIIGQGSKLLAIDVGVVIFSIVMMLFVNKLLHGDKN
    N315            GITFSSKYLLRFAIILYGLKLNIFDIIGQGSKLLAIDVGVVIFSIVMMLFVNKLLHGDKN
    NCTC8325        GITFSSKYLLRFAIILYGLKLNIFDIIGQGSKLLAIDVGVVIFSIVMMLFVNKLLHGDKN
    Newman          GITFSSKYLLRFAIILYGLKLNIFDIIGQGSKLLAIDVGVVIFSIVMMLFVNKLLHGDKN
    USA300_FPR3757  GITFSSKYLLRFAIILYGLKLNIFDIIGQGSKLLAIDVGVVIFSIVMMLFVNKLLHGDKN
                    ************************************************************

    COL             IALLLGVGTGVCGAAAIAAVAPIFKSREKDTAISIGIIALIGTIFSLIYTAIYAIFSMTT
    N315            IALLLGVGTGVCGAAAIAAVAPIFKSREKDTAISIGIIALIGTIFSLIYTAIYAIFSMTT
    NCTC8325        IALLLGVGTGVCGAAAIAAVAPIFKSREKDTAISIGIIALIGTIFSLIYTAIYAIFSMTT
    Newman          IALLLGVGTGVCGAAAIAAVAPIFKSREKDTAISIGIIALIGTIFSLIYTAIYAIFSMTT
    USA300_FPR3757  IALLLGVGTGVCGAAAIAAVAPIFKSREKDTAISIGIIALIGTIFSLIYTAIYAIFSMTT
                    ************************************************************

    COL             NVYGAWSGVSLHEIAHVVLAGGFGGSDALKIALLGKLGRVFLLIPLTIVLILIMRFRSSE
    N315            NVYGAWSGVSLHEIAHVVLAGGFGGSDALKIALLGKLGRVFLLIPLTIVLILIMRFRSSE
    NCTC8325        NVYGAWSGVSLHEIAHVVLAGGFGGSDALKIALLGKLGRVFLLIPLTIVLILIMRFRSSE
    Newman          NVYGAWSGVSLHEIAHVVLAGGFGGSDALKIALLGKLGRVFLLIPLTIVLILIMRFRSSE
    USA300_FPR3757  NVYGAWSGVSLHEIAHVVLAGGFGGSDALKIALLGKLGRVFLLIPLTIVLILIMRFRSSE
                    ************************************************************

    COL             SSSKGRISIPYFLIGFVIMALVNTYVTIPSALLNILNTVSTICLLMAMVALGLNVAFKDL
    N315            SSSKGRISIPYFLIGFVIMALVNTYVTIPSVLLNILNTISTICLLMAMVALGLNVAFKDL
    NCTC8325        SSSKGRISIPYFLIGFVIMALVNTYVTIPSALLNILNTVSTICLLMAMVALGLNVAFKDL
    Newman          SSSKGRISIPYFLIGFVIMALVNTYVTIPSALLNILNTVSTICLLMAMVALGLNVAFKDL
    USA300_FPR3757  SSSKGRISIPYFLIGFVIMALVNTYVTIPSALLNILNTVSTICLLMAMVALGLNVAFKDL
                    ******************************.*******:*********************

    COL             KNRALKPLMTIIITSICLSSLAFIVVHWLYS
    N315            KNRALKPLMTIIITSICLSSLAFIVVHWLYS
    NCTC8325        KNRALKPLMTIIITSICLSSLAFIVVHWLYS
    Newman          KNRALKPLMTIIITSICLSSLAFIVVHWLYS
    USA300_FPR3757  KNRALKPLMTIIITSICLSSLAFIVVHWLYS
                    *******************************