From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001891000
  • symbol?:
  • description?: phage envelope protein-like protein

      descriptions from strain specific annotations:

    • phage envelope protein-like protein
    • putative bacteriophage envelope protein
    • Sec-independent protein translocase protein
  • strand?: -
  • coordinates?: 2379701..2380090
  • synteny block?: BlockID0012640
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0346
    08BA02176:
    C248_0403
    11819-97:
    MS7_0338
    71193:
    ST398NM01_0428
    ECT-R 2:
    ECTR2_309
    ED133:
    SAOV_0372c
    ED98:
    SAAV_0316
    HO 5096 0412:
    SAEMRSA15_03030
    JH1:
    SaurJH1_0406
    JH9:
    SaurJH9_0396
    JKD6008:
    SAA6008_00325
    JKD6159:
    SAA6159_00322
    LGA251:
    SARLGA251_03100
    M013:
    M013TW_0327
    MRSA252:
    SAR0345
    MSHR1132:
    SAMSHR1132_03210
    MSSA476:
    SAS0324
    Mu3:
    SAHV_0345
    Mu50:
    SAV0348
    MW2:
    MW0324
    RF122:
    SAB0298c
    ST398:
    SAPIG0428
    T0131:
    SAT0131_00355
    TCH60:
    HMPREF0772_10146
    TW20:
    SATW20_04160
    USA300_TCH1516:
    USA300HOU_0369
    VC40:
    SAVC_01490

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAFTLSAIQQAHQQFTGVDFPKLFKAFKDMGMTYNIVNIQDGTATYVHQSEDDIVTSSVK
    N315            MAFTLSAIQQAHQQFTGVDFPKLFKAFKDMGMTYNIVNIQDGTATYVHQSEDDIVTSSVK
    NCTC8325        MAFTLSAIQQAHQQFTGVDFPKLFKAFKDMGMTYNIVNIQDGTATYVHQSEDDIVTSSVK
    Newman          MAFTLSAIQQAHQQFTGVDFPKLFKAFKDMGMTYNIVNIQDGTATYVHQSEDDIVTSSVK
    USA300_FPR3757  MAFTLSAIQQAHQQFTGVDFPKLFKAFKDMGMTYNIVNIQDGTATYVHQSEDDIVTSSVK
                    ************************************************************

    COL             SNHPVAQKSNKTIVQDVLTRHQQGQTDFETFCDEMAEAGIYKWHIDIQAGTCTYIDLQDQ
    N315            SNHPVAQKSNKTIVQDVLTRHQQGQTDFETFCDEMAEAGIYKWHIDIQAGTCTYIDLKEQ
    NCTC8325        SNHPVAQKSNKTIVQDVLTRHQQGQTDFETFCDEMAEAGIYKWHIDIQAGTCTYIDLQDQ
    Newman          SNHPVAQKSNKTIVQDVLTRHQQGQTDFETFCDEMAEAGIYKWHIDIQAGTCTYIDLQDQ
    USA300_FPR3757  SNHPVAQKSNKTIVQDVLTRHQQGQTDFETFCDEMAEAGIYKWHIDIQAGTCTYIDLQDQ
                    *********************************************************::*

    COL             AVISELIPQ
    N315            AIISELIPQ
    NCTC8325        AVISELIPQ
    Newman          AVISELIPQ
    USA300_FPR3757  AVISELIPQ
                    *:*******