From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001896000
  • symbol?:
  • description?: Low temperature requirement protein A

      descriptions from strain specific annotations:

    • Low temperature requirement protein A
    • low temperature requirement A protein (LtrA) family protein
    • bacterial low temperature requirement A family protein
    • bacterial low temperature requirement protein A
    • low temperature requirement protein LtrA
  • strand?: -
  • coordinates?: 2383336..2384412
  • synteny block?: BlockID0012690
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0351
    08BA02176:
    C248_0408 (ltrA)
    11819-97:
    MS7_0343
    71193:
    ST398NM01_0433
    ECT-R 2:
    ECTR2_314
    ED133:
    SAOV_0377c
    ED98:
    SAAV_0321
    HO 5096 0412:
    SAEMRSA15_03080
    JH1:
    SaurJH1_0411
    JH9:
    SaurJH9_0401
    JKD6008:
    SAA6008_00330 (ltrA)
    JKD6159:
    SAA6159_00327 (ltrA)
    LGA251:
    SARLGA251_03150
    M013:
    M013TW_0332
    MRSA252:
    SAR0350
    MSHR1132:
    SAMSHR1132_03260
    MSSA476:
    SAS0329
    Mu3:
    SAHV_0350
    Mu50:
    SAV0353
    MW2:
    MW0329
    RF122:
    SAB0303c
    ST398:
    SAPIG0433 (ltrA)
    T0131:
    SAT0131_00360
    TCH60:
    HMPREF0772_10141 (ltrA)
    TW20:
    SATW20_04210
    USA300_TCH1516:
    USA300HOU_0374
    VC40:
    SAVC_01515

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVNALTPKHLAEKRAGFHELFFDLIFVYAIQKIAHVILTTQNGSISADLFFKYIVMSLFL
    N315            MVNALTPKHLAEKRAGFHELFFDLIFVYAIQKIAHVILTTQNGSISADLFFKYIVMSLFL
    NCTC8325        MVNALTPKHLAEKRAGFHELFFDLIFVYAIQKIAHVILTTQNGSISADLFFKYIVMSLFL
    Newman          MVNALTPKHLAEKRAGFHELFFDLIFVYAIQKIAHVILTTQNGSISADLFFKYIVMSLFL
    USA300_FPR3757  MVNALTPKHLAEKRAGFHELFFDLIFVYAIQKIAHVILTTQNGSISADLFFKYIVMSLFL
                    ************************************************************

    COL             WLMWSHQTFFTNRFGQVTFKDVSFMMFNMFIMVFLSNSLYPDFEKTFFPFFLCVAIMYLS
    N315            WLMWSHQTFFTNRFGQVTFKDVSFMMFNMFIMVFLSNSLYPDFEKTFFPFFLCVAIMYLS
    NCTC8325        WLMWSHQTFFTNRFGQVTFKDVSFMMFNMFIMVFLSNSLYPDFEKTFFPFFLCVAIMYLS
    Newman          WLMWSHQTFFTNRFGQVTFKDVSFMMFNMFIMVFLSNSLYPDFEKTFFPFFLCVAIMYLS
    USA300_FPR3757  WLMWSHQTFFTNRFGQVTFKDVSFMMFNMFIMVFLSNSLYPDFEKTFFPFFLCVAIMYLS
                    ************************************************************

    COL             IGLQYLLHIRTGLDYGDKRTCQAFASVAFVISFLSFLSLVLPQSIHYIPGFLGVFIAATG
    N315            IGLQYLLHIRTGLDYGDKRTCQAFASVAFVISFLSFLSLVLPQSIHYIPGFLGVFIAATG
    NCTC8325        IGLQYLLHIRTGLDYGDKRTCQAFASVAFVISFLSFLSLVLPQSIHYIPGFLGVFIAATG
    Newman          IGLQYLLHIRTGLDYGDKRTCQAFASVAFVISFLSFLSLVLPQSIHYIPGFLGVFIAATG
    USA300_FPR3757  IGLQYLLHIRTGLDYGDKRTCQAFASVAFVISFLSFLSLVLPQSIHYIPGFLGVFIAATG
                    ************************************************************

    COL             LIPFQKYLVLSPVNMMHLVERFSLLTIIIFGEVLVGLASSSFSIDHFSYIYIFQFMILIS
    N315            LIPFQKYLVLSPVNMMHLVERFSLLTIIIFGEVLVGLASSSFSIDHFSYIYIFQFMILIS
    NCTC8325        LIPFQKYLVLSPVNMMHLVERFSLLTIIIFGEVLVGLASSSFSIDHFSYIYIFQFMILIS
    Newman          LIPFQKYLVLSPVNMMHLVELFSLLTIIIFGEVLVGLASSSFSIDHFSYIYIFQFMILIS
    USA300_FPR3757  LIPFQKYLVLSPVNMMHLVERFSLLTIIIFGEVLVGLASSSFSIDHFSYIYIFQFMILIS
                    ******************** ***************************************

    COL             LFGVYWIITENYINHKLTSIGFRLSYTHLLINIALGVINAAIVFSNNNKLNDLFEINMMY
    N315            LFGVYWIITENYINHKLSSIGFRLSYTHLLINIALGVINAAIVFSNNNKLNDLFEINMMY
    NCTC8325        LFGVYWIITENYINHKLTSIGFRLSYTHLLINIALGVINAAIVFSNNNKLNDLFEINMMY
    Newman          LFGVYWIITENYINHKLTSIGFRLSYTHLLINIALGVINAAIVFSNNNKLNDLFEINMMY
    USA300_FPR3757  LFGVYWIITENYINHKLTSIGFRLSYTHLLINIALGVINAAIVFSNNNKLNDLFEINMMY
                    *****************:******************************************

    COL             ISVLIFYIGLWLITPYFHNELTNAKYISYSLGILVMSYIVSLLFKGHDHVMIISVSVATF
    N315            ISVLIFYIGLWLITPYFHNELTNAKYISSSLGILVVSYIISLIFKGHDQVMIISVSVATF
    NCTC8325        ISVLIFYIGLWLITPYFHNELTNAKYISYSLGILVMSYIVSLLFKGHDHVMIISVSVATF
    Newman          ISVLIFYIGLWLITPYFHNELTNAKYISYSLGILVMSYIVSLLFKGHDHVMIISVSVATF
    USA300_FPR3757  ISVLIFYIGLWLITPYFHNELTNAKYISYSLGILVMSYIVSLLFKGHDHVMIISVSVATF
                    **************************** ******:***:**:*****:***********

    COL             CIMLIYFKNQRLRNKHE
    N315            CIMLIYFKNQRLRNKHE
    NCTC8325        CIMLIYFKNQRLRNKHE
    Newman          CIMLIYFKNQRLRNKHE
    USA300_FPR3757  CIMLIYFKNQRLRNKHE
                    *****************