From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001901000
  • symbol?: metF
  • description?: bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase

      descriptions from strain specific annotations:

    • bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase
    • bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase protein
    • 5,10-methylenetetrahydrofolate reductase-like homocysteine-binding domain protein
    • homocysteine S-methyltransferase family protein
    • Methylenetetrahydrofolate reductase
    • methylenetetrahydrofolate reductase family protein
    • 5-methyltetrahydrofolate--homocysteine methyltransferase
    • 5-methyltetrahydrofolate--homocysteine methyltransferase, putative
  • strand?: -
  • coordinates?: 2389407..2391248
  • synteny block?: BlockID0012740
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0349 (metH)
    USA300_FPR3757:
    04-02981:
    SA2981_0355
    08BA02176:
    C248_0413
    11819-97:
    MS7_0347
    71193:
    ST398NM01_0437
    ECT-R 2:
    ECTR2_318
    ED133:
    SAOV_0381c
    ED98:
    SAAV_0325
    HO 5096 0412:
    SAEMRSA15_03120
    JH1:
    SaurJH1_0415
    JH9:
    SaurJH9_0405
    JKD6008:
    SAA6008_00334 (metH)
    JKD6159:
    SAA6159_00331 (metH)
    LGA251:
    SARLGA251_03190
    M013:
    M013TW_0336
    MRSA252:
    SAR0354
    MSHR1132:
    SAMSHR1132_03300
    MSSA476:
    SAS0333
    Mu3:
    SAHV_0354
    Mu50:
    SAV0357
    MW2:
    MW0333
    RF122:
    SAB0307c (metE2)
    ST398:
    SAPIG0437
    T0131:
    SAT0131_00364
    TCH60:
    HMPREF0772_10137
    TW20:
    SATW20_04250
    USA300_TCH1516:
    USA300HOU_0378
    VC40:
    SAVC_01535

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSQFLTQLKDNVLVADGAIGTILYSEGLDTCPEAYNLSHPDKVERIHRSYIEAGADVIQT
    N315            MSQFLTQLKDNVLVADGAIGTILYSEGLDTCPEAYNLSHPDKVERIHRSYIEAGADVIQT
    NCTC8325        MSQFLTQLKDNVLVADGAIGTILYSEGLDTCPEAYNLSHPDKVERIHRSYIEAGADVIQT
    Newman          MSQFLTQLKDNVLVADGAIGTILYSEGLDTCPEAYNLSHPDKVERIHRSYIEAGADVIQT
    USA300_FPR3757  MSQFLTQLKDNVLVADGAIGTILYSEGLDTCPEAYNLSHPDKVERIHRSYIEAGADVIQT
                    ************************************************************

    COL             NTYGANFEKLKRFGLEDKVKAIHQAAVRIAKKAANKDTYILGTVGGFRGIKQEDISLQTI
    N315            NTYGANFEKLKRFGLEDKVKAIHQAAVRIAKKAANKDTYILGTVGGFRGIKQEDISLQTI
    NCTC8325        NTYGANFEKLKRFGLEDKVKAIHQAAVRIAKKAANKDTYILGTVGGFRGIKQEDISLQTI
    Newman          NTYGANFEKLKRFGLEDKVKAIHQAAVRIAKKAANKDTYILGTVGGFRGIKQEDISLQTI
    USA300_FPR3757  NTYGANFEKLKRFGLEDKVKAIHQAAVRIAKKAANKDTYILGTVGGFRGIKQEDISLQTI
                    ************************************************************

    COL             LYHTEIQIDTLIEEGVDALLFETYYDLEELTNVISRTRKKYDIPIIAQLTASNTNYLVNG
    N315            LYHTEIQIDTLIEEGVDALLFETYYDLEELTNVISRTRKKYDIPIIAQLTASNTNYLVNG
    NCTC8325        LYHTEIQIDTLIEEGVDALLFETYYDLEELTNVISRTRKKYDIPIIAQLTASNTNYLVNG
    Newman          LYHTEIQIDTLIEEGVDALLFETYYDLEELTNVISRTRKKYDIPIIAQLTASNTNYLVNG
    USA300_FPR3757  LYHTEIQIDTLIEEGVDALLFETYYDLEELTNVISRTRKKYDIPIIAQLTASNTNYLVNG
                    ************************************************************

    COL             QAINEGLKQLVQCGANIVGLNCHHGPHHMQESFTHIELPEHAFLSCYPNASLLDIENSEF
    N315            QAINEGLKQLVQCGANIVGLNCHHGPHHMQESFTHIELPEHAFLSCYPNASLLDIENSEF
    NCTC8325        QAINEGLKQLVQCGANIVGLNCHHGPHHMQESFTHIELPEHAFLSCYPNASLLDIENSEF
    Newman          QAINEGLKQLVQCGANIVGLNCHHGPHHMQESFTHIELPEHAFLSCYPNASLLDIENSEF
    USA300_FPR3757  QAINEGLKQLVQCGANIVGLNCHHGPHHMQESFTHIELPEHAFLSCYPNASLLDIENSEF
                    ************************************************************

    COL             KYSDNAQYFGQVAQNLIREGVRLIGGCCGTTPEHIKFIKESIQTLKPVNDKKVIPIPTKA
    N315            KYSDNAQYFGQVAQNLIREGVRLIGGCCGTTPEHIKFIKESIQTLKPVNDKKVIPIPTKA
    NCTC8325        KYSDNAQYFGQVAQNLIREGVRLIGGCCGTTPEHIKFIKESIQTLKPVNDKKVIPIPTKA
    Newman          KYSDNAQYFGQVAQNLIREGVRLIGGCCGTTPEHIKFIKESIQTLKPVNDKKVIPIPTKA
    USA300_FPR3757  KYSDNAQYFGQVAQNLIREGVRLIGGCCGTTPEHIKFIKESIQTLKPVNDKKVIPIPTKA
                    ************************************************************

    COL             LFNPSQNKVRQSLTSKVQERPTVIIELDTPKHLDTDRFFENIAKLDKANVDAVTLADNSL
    N315            LFNPSQNKVRQSLTSKVQERPTVIIELDTPKHLDTDRFFENIAKLDKANVDAVTLADNSL
    NCTC8325        LFNPSQNKVRQSLTSKVQERPTVIIELDTPKHLDTDRFFENIAKLDKANVDAVTLADNSL
    Newman          LFNPSQNKVRQSLTSKVQERPTVIIELDTPKHLDTDRFFENIAKLDKANVDAVTLADNSL
    USA300_FPR3757  LFNPSQNKVRQSLTSKVQERPTVIIELDTPKHLDTDRFFENIAKLDKANVDAVTLADNSL
                    ************************************************************

    COL             ATVRISNIAAASLIKQYYNIEPLVHITCRDRNLIGLQSHLLGLSLIGVNEILAITGDPSK
    N315            ATVRISNIAAASLIKQYYNIEPLVHITCRDRNLIGLQSHLLGLSLIGVNEILAITGDPSK
    NCTC8325        ATVRISNIAAASLIKQYYNIEPLVHITCRDRNLIGLQSHLLGLSLIGVNEILAITGDPSK
    Newman          ATVRISNIAAASLIKQYYNIEPLVHITCRDRNLIGLQSHLLGLSLIGVNEILAITGDPSK
    USA300_FPR3757  ATVRISNIAAASLIKQYYNIEPLVHITCRDRNLIGLQSHLLGLSLIGVNEILAITGDPSK
                    ************************************************************

    COL             VGHLPGATNVYDVNSKGLTELALRFNQGINTDGDALKKRTHFNIAGAFNPNVRKLYGAVK
    N315            VGHLPGATNVYDVNSKGLTELALRFNQGINTDGDALKKRTHFNIAGAFNPNVRKLDGAVK
    NCTC8325        VGHLPGATNVYDVNSKGLTELALRFNQGINTDGDALKKRTHFNIAGAFNPNVRKLYGAVK
    Newman          VGHLPGATNVYDVNSKGLTELALRFNQGINTDGDALKKRTHFNIAGAFNPNVRKLYGAVK
    USA300_FPR3757  VGHLPGATNVYDVNSKGLTELALRFNQGINTDGDALKKRTHFNIAGAFNPNVRKLYGAVK
                    ******************************************************* ****

    COL             RLEKKIESGMSYFITQPVYSKEKIIEIYHATKHLNKPFFIGIMPIASYKNALFLHNEVPG
    N315            RLEKKIESGMSYFITQPVYSKEKIIEIYHATKHLNKPFFIGIMPIASYKNALFLHNEVPG
    NCTC8325        RLEKKIESGMSYFITQPVYSKEKIIEIYHATKHLNKPFFIGIMPIASYKNALFLHNEVPG
    Newman          RLEKKIESGMSYFITQPVYSKEKIIEIYHATKHLNKPFFIGIMPIASYKNALFLHNEVPG
    USA300_FPR3757  RLEKKIESGMSYFITQPVYSKEKIIEIYHATKHLNKPFFIGIMPIASYKNALFLHNEVPG
                    ************************************************************

    COL             IKMSDEILQQFEAVKDDKAKTRELSLKLSKDLIDTVHEYFNGLYIITPFQNVEDSLELAA
    N315            IKMSDEILQQFEAVKDDKAKTRELSLKLSKDLIDTVHEYFNGLYIITPFQNVEDSLELAA
    NCTC8325        IKMSDEILQQFEAVKDDKAKTRELSLKLSKDLIDTVHEYFNGLYIITPFQNVEDSLELAA
    Newman          IKMSDEILQQFEAVKDDKAKTRELSLKLSKDLIDTVHEYFNGLYIITPFQNVEDSLELAA
    USA300_FPR3757  IKMSDEILQQFEAVKDDKAKTRELSLKLSKDLIDTVHEYFNGLYIITPFQNVEDSLELAA
                    ************************************************************

    COL             YSKSITAHKEAIL
    N315            YSKSITAHKEAIL
    NCTC8325        YSKSITAHKEAIL
    Newman          YSKSITAHKEAIL
    USA300_FPR3757  YSKSITAHKEAIL
                    *************