From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001902000
  • symbol?: metC
  • description?: cystathionine beta-lyase

      descriptions from strain specific annotations:

    • cystathionine beta-lyase
    • cystathionine gamma-synthase
    • trans-sulfuration enzyme family protein
    • cystathionine gamma-synthase (CGS) (O-succinylhomoserine(thiol)-lyase)
    • Cys/Met metabolism PLP-dependent enzyme
    • bifunctional cystathionine gamma-lyase/gamma-synthase
    • aminotransferase class-V family protein
    • cystathionine beta-lyase (CBL) (Beta-cystathionase)(Cysteine lyase)
  • strand?: -
  • coordinates?: 2391217..2392377
  • synteny block?: BlockID0012750
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0356
    08BA02176:
    C248_0414
    11819-97:
    MS7_0348
    71193:
    ST398NM01_0438
    ECT-R 2:
    ECTR2_319
    ED133:
    SAOV_0382c
    ED98:
    SAAV_0326
    HO 5096 0412:
    SAEMRSA15_03130
    JH1:
    SaurJH1_0416
    JH9:
    SaurJH9_0406
    JKD6008:
    SAA6008_00335
    JKD6159:
    SAA6159_00332
    LGA251:
    SARLGA251_03200
    M013:
    M013TW_0337
    MRSA252:
    SAR0355
    MSHR1132:
    SAMSHR1132_03310
    MSSA476:
    SAS0334
    Mu3:
    SAHV_0355
    Mu50:
    SAV0358
    MW2:
    MW0334
    RF122:
    SAB0308c
    ST398:
    SAPIG0438
    T0131:
    SAT0131_00365
    TCH60:
    HMPREF0772_10136 (metC2)
    TW20:
    SATW20_04260
    USA300_TCH1516:
    USA300HOU_0379
    VC40:
    SAVC_01540

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTLSKETEVIFDWRRGVEYHSANPPLYDSSTFHQTSLGGDVKYDYARSGNPNRELLEEKL
    N315            MTLSKETEVIFDWRRGVEYHSANPPLYDSSTFHQTSLGGDVKYDYARSGNPNRELLEEKL
    NCTC8325        MTLSKETEVIFDWRRGVEYHSANPPLYDSSTFHQTSLGGDVKYDYARSGNPNRELLEEKL
    Newman          MTLSKETEVIFDWRRGVEYHSANPPLYDSSTFHQTSLGGDVKYDYARSGNPNRELLEEKL
    USA300_FPR3757  MTLSKETEVIFDWRRGVEYHSANPPLYDSSTFHQTSLGGDVKYDYARSGNPNRELLEEKL
                    ************************************************************

    COL             ARLEQGKFAFAFASGIAAISAVLLTFKSGDHVILPDDVYGGTFRLTEQILNRFNIEFTTV
    N315            ARLEQGKFAFAFASGIAAISAVLLTFKSGDHVILPDDVYGGTFRLTEQILNRFNIEFTTV
    NCTC8325        ARLEQGKFAFAFASGIAAISAVLLTFKSGDHVILPDDVYGGTFRLTEQILNRFNIEFTTV
    Newman          ARLEQGKFAFAFASGIAAISAVLLTFKSGDHVILPDDVYGGTFRLTEQILNRFNIEFTTV
    USA300_FPR3757  ARLEQGKFAFAFASGIAAISAVLLTFKSGDHVILPDDVYGGTFRLTEQILNRFNIEFTTV
                    ************************************************************

    COL             DTTKLEQIEGAIQSNTKLIYIETPSNPCFKITDIKAVSKIAEKHELLVAVDNTFMTPLGQ
    N315            DTTKLEQIEGAIQSNTKLIYIETPSNPCFKITDIKAVSKIAEKHELLVAVDNTFMTPLGQ
    NCTC8325        DTTKLEQIEGAIQSNTKLIYIETPSNPCFKITDIKAVSKIAEKHELLVAVDNTFMTPLGQ
    Newman          DTTKLEQIEGAIQSNTKLIYIETPSNPCFKITDIKAVSKIAEKHELLVAVDNTFMTPLGQ
    USA300_FPR3757  DTTKLEQIEGAIQSNTKLIYIETPSNPCFKITDIKAVSKIAEKHELLVAVDNTFMTPLGQ
                    ************************************************************

    COL             SPLLLGADIVIHSATKFLSGHSDLIAGAVITNNEAISDALYLIQNGTGNMLSAQDSWTLA
    N315            SPLLLGADIVIHSATKFLSGHSDLIAGAVITNNEAISEALYLIQNGTGNMLSAQDSWTLA
    NCTC8325        SPLLLGADIVIHSATKFLSGHSDLIAGAVITNNEAISDALYLIQNGTGNMLSAQDSWTLA
    Newman          SPLLLGADIVIHSATKFLSGHSDLIAGAVITNNEAISDALYLIQNGTGNMLSAQDSWTLA
    USA300_FPR3757  SPLLLGADIVIHSATKFLSGHSDLIAGAVITNNEAISDALYLIQNGTGNMLSAQDSWTLA
                    *************************************:**********************

    COL             KHLKTFPIRFKQSVENAQKIVSFLIKQDEISEVYYPGLTTAHLEQAKNGGAVIGFRLADE
    N315            KHLKTFPIRFKQSVENAQKIVSFLIKQDEISEVYYPGLTTAHLEQAKNGGAVIGFRLADE
    NCTC8325        KHLKTFPIRFKQSVENAQKIVSFLIKQDEISEVYYPGLTTAHLEQAKNGGAVIGFRLADE
    Newman          KHLKTFPIRFKQSVENAQKIVSFLIKQDEISEVYYPGLTTAHLEQAKNGGAVIGFRLADE
    USA300_FPR3757  KHLKTFPIRFKQSVENAQKIVSFLIKQDEISEVYYPGLTTAHLEQAKNGGAVIGFRLADE
                    ************************************************************

    COL             SKAQQFVDALTLPLVSVSLGGVETILSHPATMSHAALPEEVRQERGITFGLFRLSVGLED
    N315            SKAQQFVDALTLPLVSVSLGGVETILSHPATMSHAALPEEVRQERGITFGLFRLSVGLED
    NCTC8325        SKAQQFVDALTLPLVSVSLGGVETILSHPATMSHAALPEEVRQERGITFGLFRLSVGLED
    Newman          SKAQQFVDALTLPLVSVSLGGVETILSHPATMSHAALPEEVRQERGITFGLFRLSVGLED
    USA300_FPR3757  SKAQQFVDALTLPLVSVSLGGVETILSHPATMSHAALPEEVRQERGITFGLFRLSVGLED
                    ************************************************************

    COL             PDELIADIKYALKEAFNESIPHTIER
    N315            PDELIADIKYALKEAFNESIPHTIER
    NCTC8325        PDELIADIKYALKEAFNESIPHTIER
    Newman          PDELIADIKYALKEAFNESIPHTIER
    USA300_FPR3757  PDELIADIKYALKEAFNESIPHTIER
                    **************************