From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001908000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 2396063..2396266
  • synteny block?: BlockID0012810
  • occurrence?: in 88% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0360
    08BA02176:
    C248_0419
    11819-97:
    MS7_0352
    71193:
    ECT-R 2:
    ECTR2_323
    ED133:
    SAOV_0386
    ED98:
    SAAV_0330
    HO 5096 0412:
    SAEMRSA15_03170
    JH1:
    SaurJH1_0421
    JH9:
    SaurJH9_0410
    JKD6008:
    SAA6008_00339
    JKD6159:
    SAA6159_00336
    LGA251:
    SARLGA251_03240
    M013:
    MRSA252:
    SAR0359
    MSHR1132:
    SAMSHR1132_03350
    MSSA476:
    SAS0338
    Mu3:
    SAHV_0359
    Mu50:
    SAV0362
    MW2:
    MW0338
    RF122:
    SAB0313
    ST398:
    SAPIG0442
    T0131:
    SAT0131_00370 (dnaI)
    TCH60:
    TW20:
    SATW20_04300
    USA300_TCH1516:
    USA300HOU_0383
    VC40:
    SAVC_01560

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MASKYGINDIVEMKKQHACGTNRFKIIRMGADIRIKCENCQRSIMIPRQTFDKKLKKIIE
    N315            MASKYGINDIVEMKKQHACGTNRFKIIRMGADIRIKCENCQRSIMIPRQTFDKKLKKIIV
    NCTC8325        MASKYGINDIVEMKKQHACGTNRFKIIRMGADIRIKCENCQRSIMIPRQTFDKKLKKIIE
    USA300_FPR3757  MASKYGINDIVEMKKQHACGTNRFKIIRMGADIRIKCENCQRSIMIPRQTFDKKLKKIIE
                    *********************************************************** 

    COL             SHDDTQR
    N315            SQDDTQR
    NCTC8325        SHDDTQR
    USA300_FPR3757  SHDDTQR
                    *:*****