From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001909000
  • symbol?: ychF
  • description?: GTP-dependent nucleic acid-binding protein EngD

      descriptions from strain specific annotations:

    • GTP-dependent nucleic acid-binding protein EngD
    • GTP-binding protein YchF
    • GTP-binding and nucleic acid-binding protein YchF
    • putative GTP-binding protein
    • ychF, translation-associated GTPase
  • strand?: +
  • coordinates?: 2396278..2397375
  • synteny block?: BlockID0012820
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0361 (ychF)
    08BA02176:
    C248_0420 (ychF)
    11819-97:
    MS7_0353 (ychF)
    71193:
    ST398NM01_0443
    ECT-R 2:
    ECTR2_324
    ED133:
    SAOV_0387
    ED98:
    SAAV_0331
    HO 5096 0412:
    SAEMRSA15_03180
    JH1:
    SaurJH1_0422 (ychF)
    JH9:
    SaurJH9_0411 (ychF)
    JKD6008:
    SAA6008_00340 (ychF)
    JKD6159:
    SAA6159_00337 (ychF)
    LGA251:
    SARLGA251_03250
    M013:
    M013TW_0341
    MRSA252:
    SAR0360 (ychF)
    MSHR1132:
    SAMSHR1132_03360
    MSSA476:
    SAS0339 (ychF)
    Mu3:
    SAHV_0360
    Mu50:
    SAV0363 (ychF)
    MW2:
    MW0339 (ychF)
    RF122:
    SAB0314 (ychF)
    ST398:
    SAPIG0443 (ychF)
    T0131:
    SAT0131_00371 (dnaB)
    TCH60:
    HMPREF0772_10132 (ychF)
    TW20:
    SATW20_04310
    USA300_TCH1516:
    USA300HOU_0384
    VC40:
    SAVC_01565

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MALTAGIVGLPNVGKSTLFNAITKAGALAANYPFATIDPNVGIVEVPDARLLKLEEMVQP
    N315            MALTAGIVGLPNVGKSTLFNAITKAGALAANYPFATIDPNVGIVEVPDARLLKLEEMVQP
    NCTC8325        MALTAGIVGLPNVGKSTLFNAITKAGALAANYPFATIDPNVGIVEVPDARLLKLEEMVQP
    Newman          MALTAGIVGLPNVGKSTLFNAITKAGALAANYPFATIDPNVGIVEVPDARLLKLEEMVQP
    USA300_FPR3757  MALTAGIVGLPNVGKSTLFNAITKAGALAANYPFATIDPNVGIVEVPDARLLKLEEMVQP
                    ************************************************************

    COL             KKTLPTTFEFTDIAGIVKGASKGEGLGNKFLSHIREVDAICQVVRAFDDDNVTHVAGRVD
    N315            KKTLPTTFEFTDIAGIVKGASKGEGLGNKFLSHIREVDAICQVVRAFDDDNVTHVAGRVD
    NCTC8325        KKTLPTTFEFTDIAGIVKGASKGEGLGNKFLSHIREVDAICQVVRAFDDDNVTHVAGRVD
    Newman          KKTLPTTFEFTDIAGIVKGASKGEGLGNKFLSHIREVDAICQVVRAFDDDNVTHVAGRVD
    USA300_FPR3757  KKTLPTTFEFTDIAGIVKGASKGEGLGNKFLSHIREVDAICQVVRAFDDDNVTHVAGRVD
                    ************************************************************

    COL             PIDDIEVINMELVLADLESVEKRLPRIEKLARQKDKTAEMEVRILTTIKEALENGKPARS
    N315            PIDDIEVINMELVLADLESVEKRLPRIEKLARQKDKTAEMEVRILTTIKEALENGKPARS
    NCTC8325        PIDDIEVINMELVLADLESVEKRLPRIEKLARQKDKTAEMEVRILTTIKEALENGKPARS
    Newman          PIDDIEVINMELVLADLESVEKRLPRIEKLARQKDKTAEMEVRILTTIKEALENGKPARS
    USA300_FPR3757  PIDDIEVINMELVLADLESVEKRLPRIEKLARQKDKTAEMEVRILTTIKEALENGKPARS
                    ************************************************************

    COL             IDFNEEDQKWVNQAQLLTSKKMLYIANVGEDEIGDDDNDKVKAIREYAAQEDSEVIVISA
    N315            IDFNEEDQKWVNQAQLLTSKKMLYIANVGEDEIGDDDNDKVKAIREYAAQEDSEVIVISA
    NCTC8325        IDFNEEDQKWVNQAQLLTSKKMLYIANVGEDEIGDDDNDKVKAIREYAAQEDSEVIVISA
    Newman          IDFNEEDQKWVNQAQLLTSKKMLYIANVGEDEIGDDDNDKVKAIREYAAQEDSEVIVISA
    USA300_FPR3757  IDFNEEDQKWVNQAQLLTSKKMLYIANVGEDEIGDDDNDKVKAIREYAAQEDSEVIVISA
                    ************************************************************

    COL             KIEEEIATLDDEDKEMFLEDLGIEEPGLDRLIRTTYELLGLSTYFTAGVQEVRAWTFKQG
    N315            KIEEEIATLDDEDKEMFLEDLGIEEPGLDRLIRTTYELLGLSTYFTAGVQEVRAWTFKQG
    NCTC8325        KIEEEIATLDDEDKEMFLEDLGIEEPGLDRLIRTTYELLGLSTYFTAGVQEVRAWTFKQG
    Newman          KIEEEIATLDDEDKEMFLEDLGIEEPGLDRLIRTTYELLGLSTYFTAGVQEVRAWTFKQG
    USA300_FPR3757  KIEEEIATLDDEDKEMFLEDLGIEEPGLDRLIRTTYELLGLSTYFTAGVQEVRAWTFKQG
                    ************************************************************

    COL             MTAPQCAGIIHTDFERGFIRAEVTSYDDYVQYGGESGAKEAGRQRLEGKEYIMQDGDIVH
    N315            MTAPQCAGIIHTDFERGFIRAEVTSYDDYVQYGGESGAKEAGRQRLEGKEYIMQDGDIVH
    NCTC8325        MTAPQCAGIIHTDFERGFIRAEVTSYDDYVQYGGESGAKEAGRQRLEGKEYIMQDGDIVH
    Newman          MTAPQCAGIIHTDFERGFIRAEVTSYDDYVQYGGESGAKEAGRQRLEGKEYIMQDGDIVH
    USA300_FPR3757  MTAPQCAGIIHTDFERGFIRAEVTSYDDYVQYGGESGAKEAGRQRLEGKEYIMQDGDIVH
                    ************************************************************

    COL             FRFNV
    N315            FRFNV
    NCTC8325        FRFNV
    Newman          FRFNV
    USA300_FPR3757  FRFNV
                    *****