From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001910000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 2397461..2399857
  • synteny block?: BlockID0012830
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0362
    08BA02176:
    C248_0421
    11819-97:
    MS7_0354
    71193:
    ST398NM01_0444
    ECT-R 2:
    ECTR2_325
    ED133:
    SAOV_0388c
    ED98:
    SAAV_0332
    HO 5096 0412:
    SAEMRSA15_03190
    JH1:
    SaurJH1_0423
    JH9:
    SaurJH9_0412
    JKD6008:
    SAA6008_00341
    JKD6159:
    SAA6159_00338
    LGA251:
    SARLGA251_03260
    M013:
    M013TW_0344
    MRSA252:
    SAR0361
    MSHR1132:
    SAMSHR1132_03370
    MSSA476:
    SAS0340
    Mu3:
    SAHV_0361
    Mu50:
    SAV0364
    MW2:
    MW0340
    RF122:
    SAB0315c
    ST398:
    SAPIG0444
    T0131:
    SAT0131_00372 (sodA1)
    TCH60:
    HMPREF0772_10131
    TW20:
    SATW20_04320
    USA300_TCH1516:
    USA300HOU_0385
    VC40:
    SAVC_01570

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNLNIDWSKDFQEFQEILNSGIHPEWLYCAKANLVLEPAYTGEGKQFFSTQDIINASKII
    N315            MNLNIDWSKDFQEFQEILNSGIHPEWLYCAKANLVLEPAYTGEGKQFFSTQDIIYASKII
    NCTC8325        MNLNIDWSKDFQEFQEILNSGIHPEWLYCAKANLVLEPAYTGEGKQFFSTQDIINASKII
    Newman          MNLNIDWSKDFQEFQEILNSGIHPEWLYCAKANLVLEPAYTGEGKQFFSTQDIINASKII
    USA300_FPR3757  MNLNIDWSKDFQEFQEILNSGIHPEWLYCAKANLVLEPAYTGEGKQFFSTQDIINASKII
                    ****************************************************** *****

    COL             PFF
    N315            PFF
    NCTC8325        PFF
    Newman          PFF
    USA300_FPR3757  PFF
                    ***