From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001915000
  • symbol?: ssb
  • description?: ssDNA-binding protein

      descriptions from strain specific annotations:

    • ssDNA-binding protein
    • single-stranded DNA-binding protein
    • single-strand binding protein
    • bacteriophage L54a, single-stranded DNA binding protein
    • single-strand DNA-binding family protein
    • single-strand DNA-binding protein of phage phi PVL
    • single-stranded DNA-binding protein (SSB) (Helix-destabilizingprotein)
    • single-strand DNA-binding protein of phage phi Sa 2mw
    • putative single-strand DNA-binding protein
    • single-stranded DNA-binding protein ssb
  • strand?: +
  • coordinates?: 2400419..2400922
  • synteny block?: BlockID0012870
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0438 (ssb2)
    N315:
    SA0353 (ssb)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0364 (ssb)
    08BA02176:
    C248_0424 (ssb)
    11819-97:
    MS7_0356
    71193:
    ST398NM01_0446
    ECT-R 2:
    ECTR2_327 (ssb)
    ED133:
    SAOV_0390 (ssb2)
    ED98:
    SAAV_0334 (ssb2)
    HO 5096 0412:
    SAEMRSA15_03210 (ssb)
    JH1:
    SaurJH1_0425
    JH9:
    SaurJH9_0414
    JKD6008:
    SAA6008_00343 (ssb)
    JKD6159:
    SAA6159_00340 (ssb)
    LGA251:
    SARLGA251_03280 (ssb)
    M013:
    M013TW_0346
    MRSA252:
    SAR0363 (ssb)
    MSHR1132:
    SAMSHR1132_03390
    MSSA476:
    SAS0342
    Mu3:
    SAHV_0363 (ssb)
    Mu50:
    SAV0366 (ssb)
    MW2:
    MW0342 (ssb)
    RF122:
    SAB0317 (ssb)
    ST398:
    SAPIG0446
    T0131:
    SAT0131_00374 (gapB)
    TCH60:
    HMPREF0772_10128 (ssb)
    TW20:
    SATW20_04340 (ssb)
    USA300_TCH1516:
    USA300HOU_0388 (ssb1)
    VC40:
    SAVC_01580

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADN
    N315            MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADN
    NCTC8325        MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADN
    Newman          MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADN
    USA300_FPR3757  MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADN
                    ************************************************************

    COL             VNNYLSKGSLAGVDGRLQSRNYENQEGRRVFVTEVVCDSVQFLEPKNAQQNGGQRQQNEF
    N315            VNNYLSKGSLAGVDGRLQSRNYENQEGRRVFVTEVVCDSVQFLEPKNAQQNGGQRQQNEF
    NCTC8325        VNNYLSKGSLAGVDGRLQSRNYENQEGRRVFVTEVVCDSVQFLEPKNAQQNGGQRQQNEF
    Newman          VNNYLSKGSLAGVDGRLQSRNYENQEGRRVFVTEVVCDSVQFLEPKNAQQNGGQRQQNEF
    USA300_FPR3757  VNNYLSKGSLAGVDGRLQSRNYENQEGRRVFVTEVVCDSVQFLEPKNAQQNGGQRQQNEF
                    ************************************************************

    COL             QDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDISDDDLPF
    N315            QDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDISDDDLPF
    NCTC8325        QDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDISDDDLPF
    Newman          QDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDISDDDLPF
    USA300_FPR3757  QDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDISDDDLPF
                    ***********************************************