Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001916000
  • symbol?: rpsR
  • description?: 30S ribosomal protein S18

      descriptions from strain specific annotations:

    • 30S ribosomal protein S18
    • 30S ribosomalprotein S18p
  • strand?: +
  • coordinates?: 2400974..2401216
  • synteny block?: BlockID0012880
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0439 (rpsR)
    N315:
    SA0354 (rpsR)
    NCTC8325:
    Newman:
    NWMN_0359 (rpsR)
    USA300_FPR3757:
    04-02981:
    SA2981_0365 (rpsR)
    08BA02176:
    C248_0425 (rpsR)
    11819-97:
    MS7_0357 (rpsR)
    71193:
    ST398NM01_0447
    ECT-R 2:
    ECTR2_328 (rpsR)
    ED133:
    SAOV_0391 (rpsR)
    ED98:
    SAAV_0335 (rpsR)
    HO 5096 0412:
    SAEMRSA15_03220 (rpsR)
    JH1:
    SaurJH1_0426 (rpsR)
    JH9:
    SaurJH9_0415 (rpsR)
    JKD6008:
    SAA6008_00344 (rpsR)
    JKD6159:
    SAA6159_00341 (rpsR)
    LGA251:
    SARLGA251_03290 (rpsR)
    M013:
    M013TW_0347
    MRSA252:
    SAR0364 (rpsR)
    MSHR1132:
    SAMSHR1132_03400
    MSSA476:
    SAS0343 (rpsR)
    Mu3:
    SAHV_0364 (rpsR)
    Mu50:
    SAV0367 (rpsR)
    MW2:
    MW0343 (rpsR)
    RF122:
    SAB0318 (rpsR)
    ST398:
    SAPIG0447 (rpsR)
    T0131:
    SAT0131_00375 (coaE)
    TCH60:
    HMPREF0772_10127 (rpsR)
    TW20:
    SATW20_04350 (rpsR)
    USA300_TCH1516:
    USA300HOU_0389 (rpsR)
    VC40:
    SAVC_01585 (rpsR)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAGGPRRGGRRRKKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRML
    N315            MAGGPRRGGRRRKKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRML
    NCTC8325        MAGGPRRGGRRRKKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRML
    Newman          MAGGPRRGGRRRKKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRML
    USA300_FPR3757  MAGGPRRGGRRRKKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRML
                    ************************************************************

    COL             TTAIKRSRHMALLPYVKEEQ
    N315            TTAIKRSRHMALLPYVKEEQ
    NCTC8325        TTAIKRSRHMALLPYVKEEQ
    Newman          TTAIKRSRHMALLPYVKEEQ
    USA300_FPR3757  TTAIKRSRHMALLPYVKEEQ
                    ********************