From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001957000
  • symbol?:
  • description?: Abi family protein

      descriptions from strain specific annotations:

    • Abi family protein
    • abi-like family protein
    • putative abortive infection bacteriophage resistance protein
  • strand?: -
  • coordinates?: 2435883..2437677
  • synteny block?: BlockID0013100
  • occurrence?: in 78% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0366
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ECTR2_329
    ED133:
    ED98:
    SAAV_0336
    HO 5096 0412:
    SAEMRSA15_03230
    JH1:
    SaurJH1_0427
    JH9:
    SaurJH9_0416
    JKD6008:
    SAA6008_00367
    JKD6159:
    SAA6159_00342
    LGA251:
    SARLGA251_03300
    M013:
    M013TW_0348
    MRSA252:
    MSHR1132:
    SAMSHR1132_03410
    MSSA476:
    SAS0344
    Mu3:
    SAHV_0365
    Mu50:
    SAV0368
    MW2:
    MW0344
    RF122:
    SAB0319c
    ST398:
    T0131:
    SAT0131_00399
    TCH60:
    TW20:
    SATW20_04360
    USA300_TCH1516:
    USA300HOU_0390
    VC40:
    SAVC_01590

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ------------MLNFDEQIAKLKQMNIFFNIIDTEKANEILRKNNYFFKLAYFRKNFEK
    N315            MEKDDILAEIKPMLNFDEQIAKLKQMNIFFNIIDTEKANEILRKNNYFFKLAYFRKNFEK
    NCTC8325        ------------MLNFDEQIAKLKQMNIFFNIIDTEKANEILRKNNYFFKLAYFRKNFEK
    Newman          MEKDDTLAEIKPMLNFDEQIAKLKQMNIFFNIIDTEKANEILRKNNYFFKLAYFRKNFEK
    USA300_FPR3757  ------------MLNFDEQIAKLKQMNIFFNIIDTEKANEILRKNNYFFKLAYFRKNFEK
                                ************************************************

    COL             KNGGYFIEFAYLSDLATIDMKLRYTMLHLTLDIEHSLKYLVLKLITENNQEDGYKIIDEF
    N315            KNGGYFIEFAYLSDLATIDMKLRYTMLHLTLDIEHSLKCLVLKLITENNQEDGYKIIDEF
    NCTC8325        KNGGYFIEFAYLSDLATIDMKLRYTMLHLTLDIEHSLKYLVLKLITENNQEDGYKIIDEF
    Newman          KNGGYFIEFAYLSDLATIDMKLRYTMLHLTLDIEHSLKYLVLKLITENNQEDGYKIIDEF
    USA300_FPR3757  KNGGYFIEFAYLSDLATIDMKLRYTMLHLTLDIEHSLKYLVLKLITENNQEDGYKIIDEF
                    ************************************** *********************

    COL             LCIDKSYSNSNFDTNSRTPEEVMETKIKNKNEIFKHMNKRGQLPEKLNKYYQNPPAWVCI
    N315            LCIDKSYSNSNFDTNSRTPEEVMETKIKNKNEIFKHMNKRGQLPEKLNKYYQNPPAWVCI
    NCTC8325        LCIDKSYSNSNFDTNSRTPEEVMETKIKNKNEIFKHMNKRGQLPEKLNKYYQNPPAWVCI
    Newman          LCIDKSYSNSNFDTNSRTPEEVMETKIKNKNEIFKHMNKRGQLPEKLNKYYQNPPAWVCI
    USA300_FPR3757  LCIDKSYSNSNFDTNSRTPEEVMETKIKNKNEIFKHMNKRGQLPEKLNKYYQNPPAWVCI
                    ************************************************************

    COL             EFMQLGQFVSFLNFYYKKYNDEELRVANILMPLVKNIRNKSAHNQPIIANLNYDSRLPQY
    N315            EFMQLGQFVSFLNFYYKKYNDEELRVANILMPLVKNIRNKSAHNQPIIANLNYDSRSPQY
    NCTC8325        EFMQLGQFVSFLNFYYKKYNDEELRVANILMPLVKNIRNKSAHNQPIIANLNYDSRLPQY
    Newman          EFMQLGQFVSFLNFYYKKYNDEELRVANILMPLVKNIRNKSAHNQPIIANLNYDSRLPQY
    USA300_FPR3757  EFMQLGQFVSFLNFYYKKYNDEELRVANILMPLVKNIRNKSAHNQPIIANLNYDSRLPQY
                    ******************************************************** ***

    COL             LFEKGNNIGISRNMFGIKNFIDTFATLELHNQVCSNAIIQARYHDLDQLQKRYKRNESYY
    N315            LFEKGNNIGISRNMFGIKNFIDTFATLELHNQVCSNAIIQARYHDLDQLQKRYKRNESYY
    NCTC8325        LFEKGNNIGISRNMFGIKNFIDTFATLELHNQVCSNAIIQARYHDLDQLQKRYKRNESYY
    Newman          LFEKGNNIGISRNMFGIKNFIDTFATLELHNQVCSNAIIQARYHDLDQLQKRYKRNESYY
    USA300_FPR3757  LFEKGNNIGISRNMFGIKNFIDTFATLELHNQVCSNAIIQARYHDLDQLQKRYKRNESYY
                    ************************************************************

    COL             NNALAIKRFFIALDKIIDFNRPKV
    N315            NNALAIKRFFIALDKIIDFNRPKV
    NCTC8325        NNALAIKRFFIALDKIIDFNRPKV
    Newman          NNALAIKRFFIALDKIIDFNRPKV
    USA300_FPR3757  NNALAIKRFFIALDKIIDFNRPKV
                    ************************